Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Human EPO/Erythropoietin ELISA Kit

Assay type:
Quantitative, Competitive

$893.00

96T + 893 loyalty points
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery
Human EPO/Erythropoietin ELISA Kit

Human EPO/Erythropoietin ELISA Kit

Product name Human EPO/Erythropoietin ELISA Kit
Uniprot ID P01588
Raw Antigen Sequence MGVHECPAWLWLLLSLLSLPLGLPVLGAPPRLICDSRVLERYLLEAKEAENITTGCAEHCSLNENITVPDTKVNFYAWKRMEVGQQAVEVWQGLALLSEAVLRGQALLVNSSQPWEPLQLHVDKAVSGLRSLTTLLRALGAQKEAISPPDAASAAPLRTITADTFRKLFRVYSNFLRGKLKLYTGEACRTGDR
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stocks, 3-5 weeks if production is needed
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Note For research use only.
Immunogen EPO
Assay type Quantitative, Competitive

Introduction

Erythropoietin (EPO) is a hormone produced by the kidneys that plays a crucial role in the production of red blood cells. This hormone has been extensively studied for its therapeutic potential in various conditions such as anemia, chronic kidney disease, and cancer. To measure the levels of EPO in biological samples, the Human EPO/Erythropoietin ELISA Kit has been developed. This article will provide a scientific description of the structure, activity, and application of this kit.

Structure of Human EPO/Erythropoietin ELISA Kit

The Human EPO/Erythropoietin ELISA Kit is a sandwich enzyme-linked immunosorbent assay (ELISA) that utilizes monoclonal antibodies specific for human EPO. The kit contains a microplate coated with a capture antibody that binds to EPO present in the sample. The kit also includes a detection antibody labeled with an enzyme, and a substrate solution that produces a colorimetric signal in the presence of the enzyme. The kit also provides a standard curve for quantification of EPO levels in the sample.

Activity of Human EPO/Erythropoietin ELISA Kit

The Human EPO/Erythropoietin ELISA Kit is a highly sensitive and specific assay for the measurement of EPO levels in human samples. The capture and detection antibodies used in the kit have been carefully selected and validated to ensure accurate and reliable results. The assay has a detection range of 0.5-32 mIU/mL, making it suitable for the measurement of both physiological and pathological levels of EPO.

The assay procedure is simple and can be completed within a few hours. The sample and standards are added to the microplate, and the EPO present in the sample is captured by the immobilized antibody. After washing away any unbound substances, the detection antibody is added, and the enzyme-labeled antibody binds to the captured EPO. The substrate solution is then added, and the colorimetric signal is measured. The intensity of the signal is directly proportional to the amount of EPO present in the sample, allowing for accurate quantification.

Application of Human EPO/Erythropoietin ELISA Kit

The Human EPO/Erythropoietin ELISA Kit has a wide range of applications in both research and clinical settings. In research, the kit can be used to measure EPO levels in various biological samples such as serum, plasma, and cell culture supernatants. This allows for the investigation of EPO levels in different physiological and pathological conditions, and the correlation between EPO levels and disease progression.

In clinical settings, the Human EPO/Erythropoietin ELISA Kit is used for the diagnosis and monitoring of anemia, chronic kidney disease, and other conditions where EPO levels may be altered. The kit can also be used to monitor the effectiveness of EPO therapy in patients receiving treatment for anemia or other conditions. Additionally, the kit can be used in the development of new EPO-based therapies and the evaluation of their efficacy.

Conclusion

The Human EPO/Erythropoietin ELISA Kit is a valuable tool for the measurement of EPO levels in biological samples. Its highly specific and sensitive assay allows for accurate quantification of EPO, making it a useful tool for both research and clinical applications. With its simple and efficient assay procedure, the kit provides a reliable and convenient method for the measurement of EPO, contributing to the advancement of EPO-related research and the development of new therapies.

Keywords:

Human EPO/Erythropoietin ELISA Kit, EPO, hormone, red blood cells, therapeutic target, research use, anemia, chronic kidney disease, cancer, sandwich ELISA, monoclonal antibodies, microplate, capture antibody, detection antibody, enzyme, substrate solution, standard curve, sensitivity, specificity

There are no reviews yet.

Be the first to review “Human EPO/Erythropoietin ELISA Kit”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products