Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Efparepoetin Biosimilar – Anti-EPO fusion protein – Research Grade

Origin species:
Human
Uniprot ID:
P01588

Original price was: $215.00.Current price is: $167.00.

50ug 22% OFF + 167 loyalty points
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Efparepoetin Biosimilar - Anti-EPO fusion protein - Research Grade

Product name PX-TA2227-50
Uniprot ID P01588
Source CAS: 2761347-19-5
Origin species Human
Expression system XtenCHO
Raw Antigen Sequence MGVHECPAWLWLLLSLLSLPLGLPVLGAPPRLICDSRVLERYLLEAKEAENITTGCAEHCSLNENITVPDTKVNFYAWKRMEVGQQAVEVWQGLALLSEAVLRGQALLVNSSQPWEPLQLHVDKAVSGLRSLTTLLRALGAQKEAISPPDAASAAPLRTITADTFRKLFRVYSNFLRGKLKLYTGEACRTGDR
Purity >95% by SDS-PAGE
Buffer 0.01M PBS, pH 7.4
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term; -20°C for long term
Brand ProteoGenix
Aliases /Synonyms anti-EPO, Erythropoietin, Epoetin
Reference PX-TA2227-100
Note For research use only. Not suitable for human use.
Isotype Human erythropoietin fragment fused via peptide linker to a Fc fragment of Ig G2
Product name Efparepoetin Biosimilar - Anti-EPO fusion protein - Research Grade
Uniprot ID P01588
Source CAS: 2761347-19-5
Origin species Human
Expression system XtenCHO
Raw Antigen Sequence MGVHECPAWLWLLLSLLSLPLGLPVLGAPPRLICDSRVLERYLLEAKEAENITTGCAEHCSLNENITVPDTKVNFYAWKRMEVGQQAVEVWQGLALLSEAVLRGQALLVNSSQPWEPLQLHVDKAVSGLRSLTTLLRALGAQKEAISPPDAASAAPLRTITADTFRKLFRVYSNFLRGKLKLYTGEACRTGDR
Purity >95% by SDS-PAGE
Buffer 0.01M PBS, pH 7.4
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term; -20°C for long term
Brand ProteoGenix
Aliases /Synonyms anti-EPO, Erythropoietin, Epoetin
Reference PX-TA2227-100
Note For research use only. Not suitable for human use.
Isotype Human erythropoietin fragment fused via peptide linker to a Fc fragment of Ig G2
Product name Efparepoetin Biosimilar - Anti-EPO fusion protein - Research Grade
Uniprot ID P01588
Source CAS: 2761347-19-5
Origin species Human
Expression system XtenCHO
Raw Antigen Sequence MGVHECPAWLWLLLSLLSLPLGLPVLGAPPRLICDSRVLERYLLEAKEAENITTGCAEHCSLNENITVPDTKVNFYAWKRMEVGQQAVEVWQGLALLSEAVLRGQALLVNSSQPWEPLQLHVDKAVSGLRSLTTLLRALGAQKEAISPPDAASAAPLRTITADTFRKLFRVYSNFLRGKLKLYTGEACRTGDR
Purity >95% by SDS-PAGE
Buffer 0.01M PBS, pH 7.4
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term; -20°C for long term
Brand ProteoGenix
Aliases /Synonyms anti-EPO, Erythropoietin, Epoetin
Reference PX-TA2227-100
Note For research use only. Not suitable for human use.
Isotype Human erythropoietin fragment fused via peptide linker to a Fc fragment of Ig G2

Introduction

Efparepoetin Biosimilar, also known as Anti-EPO fusion protein, is a therapeutic protein that has been developed as a biosimilar to Erythropoietin (EPO). EPO is a hormone produced by the kidneys that stimulates the production of red blood cells. Efparepoetin Biosimilar is designed to mimic the structure and function of EPO, making it a promising therapeutic target for conditions associated with low levels of EPO, such as anemia.

Structure of Efparepoetin Biosimilar

Efparepoetin Biosimilar is a fusion protein consisting of two components: an anti-EPO antibody and a modified form of EPO. The anti-EPO antibody is derived from a human monoclonal antibody, which specifically binds to EPO. This antibody is linked to a modified form of EPO, which has been engineered to have a longer half-life in the body. This fusion protein is produced using recombinant DNA technology, where the genes for the antibody and modified EPO are inserted into a host cell, such as a bacterial or mammalian cell, to produce the protein.

Activity of Efparepoetin Biosimilar

Efparepoetin Biosimilar works by binding to EPO receptors on the surface of cells in the bone marrow, which then stimulates the production of red blood cells. This helps to increase the number of red blood cells in the body, leading to improved oxygen delivery to tissues and organs. Additionally, the modified form of EPO in Efparepoetin Biosimilar allows for a longer duration of action, reducing the frequency of dosing compared to traditional EPO therapy.

Applications of Efparepoetin Biosimilar

Efparepoetin Biosimilar is primarily used for the treatment of anemia associated with chronic kidney disease, chemotherapy-induced anemia, and anemia in patients with HIV. It can also be used in the treatment of anemia in patients with myelodysplastic syndromes, a group of disorders where the bone marrow does not produce enough healthy blood cells. Furthermore, Efparepoetin Biosimilar has shown potential for use in other conditions such as anemia in patients with inflammatory bowel disease and anemia in critically ill patients.

Advantages of Efparepoetin Biosimilar

As a biosimilar, Efparepoetin Biosimilar offers several advantages over traditional EPO therapy. First, it is produced using recombinant DNA technology, ensuring a consistent and high-quality product. Second, it has a longer half-life, reducing the frequency of dosing and potentially improving patient compliance. Third, as a biosimilar, it is expected to have a lower cost compared to the originator product, making it more accessible to patients.

Conclusion

In summary, Efparepoetin Biosimilar is a promising therapeutic protein that mimics the structure and function of EPO. Its unique fusion protein structure and longer half-life make it a potential game-changer in the treatment of anemia associated with various conditions. With its potential to improve patient outcomes and reduce healthcare costs, Efparepoetin Biosimilar is a valuable addition to the arsenal of therapeutic proteins.

SDS-PAGE for Efparepoetin Alfa Biosimilar - Research Grade

SDS-PAGE for Efparepoetin Alfa Biosimilar - Research Grade

Efparepoetin Alfa Biosimilar - Research Grade, on SDS-PAGE. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

There are no reviews yet.

Be the first to review “Efparepoetin Biosimilar – Anti-EPO fusion protein – Research Grade”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products