Skip to main content
Contact +1 (919) 234-1277

🚀 Special Offer🚀Get 25% off on your bioreagent online order (except Micelles and Nanodiscs), with the code: PROTEOSHOP25

📢 New ! Accelerate your Antibody Development with Ready-to-use Stable Cell Pools

Explore Now
Nycodenz AG® Nycodenz AG® XtenCHO ™ Race Starter kit XtenCHO ™ Race Starter kit
View all Products

Human ID Recombinant Protein

Reference:
size

100ug, 50ug
Brand

ProteoGenix
Product type

Recombinant Proteins
Host Species

Escherichia coli (E. coli)
Applications

Elisa, WB
Tag:
Specification
Description
Documents
Publications
Reviews
Product nameHuman ID Recombinant Protein
Uniprot IDQ96NW4
Uniprot linkhttp://www.uniprot.org/uniprot/Q96NW4
Origin speciesHomo sapiens (Human)
Expression systemProkaryotic expression
Sequence(Sequence without tag) MSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYIDGDVKLTQSMAIIRYIADKHN MLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDHVTHPDFMLYDALD VVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIAWPLQGWQATFGGGDHPPKSDLVPRGSSTSSFSSMSASSRQ EETKKDYREVEKLLRAVADGDLEMVRYLLEWTEEDLEDAEDTVSAADPE
Molecular weight33,38 kDa
Protein delivered with Tag?GST
Purity estimated50%
BufferTrisHC 50mMl, pH8
Formliquid
Delivery conditionDry Ice
Delivery lead time in business days10-25
Storage condition4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
BrandProteoGenix
Host speciesEscherichia coli (E.coli)
Fragment TypePartial
Protein AccessionNP_115515.2
Spec:Entrez GeneID84079
Spec:NCBI Gene AliasesVARP, PP12899
Spec:SwissProtIDQ96NW4
NCBI ReferenceNP_115515.2
Aliases /SynonymsID, ankyrin repeat domain-containing protein 27, ANKRD27, VPS9 domain-containing protein, PP12899
ReferencePX-P1117
NoteFor research use only

Description of Human ID Recombinant Protein

Ankyrin repeat domain-containing protein 27 is a protein that in humans is encoded by the ANKRD27 gene.

Datasheet Download
MSDS Download

Publication

  • 1: Hesketh GG, Pérez-Dorado I, Jackson LP, Wartosch L, Schäfer IB, Gray SR, McCoy_x000D_ AJ, Zeldin OB, Garman EF, Harbour ME, Evans PR, Seaman MN, Luzio JP, Owen DJ._x000D_ VARP is recruited on to endosomes by direct interaction with retromer, where_x000D_ together they function in export to the cell surface. Dev Cell. 2014 Jun_x000D_ 9;29(5):591-606. doi: 10.1016/j.devcel.2014.04.010. Epub 2014 May 22. PubMed_x000D_ PMID: 24856514; PubMed Central PMCID: PMC4059916.
    • _x000D_ _x000D_ _x000D_
  • 2: Schäfer IB, Hesketh GG, Bright NA, Gray SR, Pryor PR, Evans PR, Luzio JP, Owen_x000D_ DJ. The binding of Varp to VAMP7 traps VAMP7 in a closed, fusogenically inactive _x000D_ conformation. Nat Struct Mol Biol. 2012 Dec;19(12):1300-9. doi:_x000D_ 10.1038/nsmb.2414. Epub 2012 Oct 28. PubMed PMID: 23104059; PubMed Central PMCID:_x000D_ PMC3605791.
    • _x000D_ _x000D_ _x000D_
  • 3: Wang F, Zhang H, Zhang X, Wang Y, Ren F, Zhang X, Zhai Y, Chang Z. Varp_x000D_ interacts with Rab38 and functions as its potential effector. Biochem Biophys Res_x000D_ Commun. 2008 Jul 18;372(1):162-7. doi: 10.1016/j.bbrc.2008.05.017. Epub 2008 May _x000D_ 12. PubMed PMID: 18477474.
    • _x000D_ _x000D_ _x000D_
  • 4: Yatsu A, Shimada H, Ohbayashi N, Fukuda M. Rab40C is a novel Varp-binding_x000D_ protein that promotes proteasomal degradation of Varp in melanocytes. Biol Open. _x000D_ 2015 Feb 6;4(3):267-75. doi: 10.1242/bio.201411114. PubMed PMID: 25661869; PubMed_x000D_ Central PMCID: PMC4359733.
    • _x000D_ _x000D_ _x000D_
  • 5: Sleiman PM, Wang ML, Cianferoni A, Aceves S, Gonsalves N, Nadeau K, Bredenoord_x000D_ AJ, Furuta GT, Spergel JM, Hakonarson H. GWAS identifies four novel eosinophilic _x000D_ esophagitis loci. Nat Commun. 2014 Nov 19;5:5593. doi: 10.1038/ncomms6593. PubMed_x000D_ PMID: 25407941; PubMed Central PMCID: PMC4238044.
    • _x000D_ _x000D_ _x000D_
  • 6: Zhang X, He X, Fu XY, Chang Z. Varp is a Rab21 guanine nucleotide exchange_x000D_ factor and regulates endosome dynamics. J Cell Sci. 2006 Mar 15;119(Pt_x000D_ 6):1053-62. PubMed PMID: 16525121.
    • _x000D_ _x000D_ _x000D_
  • 7: Burgo A, Proux-Gillardeaux V, Sotirakis E, Bun P, Casano A, Verraes A, Liem_x000D_ RK, Formstecher E, Coppey-Moisan M, Galli T. A molecular network for the_x000D_ transport of the TI-VAMP/VAMP7 vesicles from cell center to periphery. Dev Cell. _x000D_ 2012 Jul 17;23(1):166-80. doi: 10.1016/j.devcel.2012.04.019. Epub 2012 Jun 14._x000D_ PubMed PMID: 22705394.
    • _x000D_ _x000D_ _x000D_
  • 8: Burgo A, Sotirakis E, Simmler MC, Verraes A, Chamot C, Simpson JC, Lanzetti L,_x000D_ Proux-Gillardeaux V, Galli T. Role of Varp, a Rab21 exchange factor and_x000D_ TI-VAMP/VAMP7 partner, in neurite growth. EMBO Rep. 2009 Oct;10(10):1117-24. doi:_x000D_ 10.1038/embor.2009.186. Epub 2009 Sep 11. PubMed PMID: 19745841; PubMed Central_x000D_ PMCID: PMC2759737.
    • _x000D_ _x000D_ _x000D_
  • 9: GENDEP Investigators.; MARS Investigators.; STAR*D Investigators.. Common_x000D_ genetic variation and antidepressant efficacy in major depressive disorder: a_x000D_ meta-analysis of three genome-wide pharmacogenetic studies. Am J Psychiatry. 2013_x000D_ Feb;170(2):207-17. doi: 10.1176/appi.ajp.2012.12020237. PubMed PMID: 23377640.
    • _x000D_ _x000D_ _x000D_
  • 10: Wan D, Gong Y, Qin W, Zhang P, Li J, Wei L, Zhou X, Li H, Qiu X, Zhong F, He _x000D_ L, Yu J, Yao G, Jiang H, Qian L, Yu Y, Shu H, Chen X, Xu H, Guo M, Pan Z, Chen Y,_x000D_ Ge C, Yang S, Gu J. Large-scale cDNA transfection screening for genes related to _x000D_ cancer development and progression. Proc Natl Acad Sci U S A. 2004 Nov_x000D_ 2;101(44):15724-9. Epub 2004 Oct 21. Erratum in: Proc Natl Acad Sci U S A. 2004_x000D_ Dec 14:101(50):17565. PubMed PMID: 15498874; PubMed Central PMCID: PMC524842.
    • _x000D_ _x000D_ _x000D_
  • 11: Simpson JC, Wellenreuther R, Poustka A, Pepperkok R, Wiemann S. Systematic_x000D_ subcellular localization of novel proteins identified by large-scale cDNA_x000D_ sequencing. EMBO Rep. 2000 Sep;1(3):287-92. PubMed PMID: 11256614; PubMed Central_x000D_ PMCID: PMC1083732.
    • _x000D_ _x000D_ _x000D_
  • 12: Colland F, Jacq X, Trouplin V, Mougin C, Groizeleau C, Hamburger A, Meil A,_x000D_ Wojcik J, Legrain P, Gauthier JM. Functional proteomics mapping of a human_x000D_ signaling pathway. Genome Res. 2004 Jul;14(7):1324-32. PubMed PMID: 15231748;_x000D_ PubMed Central PMCID: PMC442148.
    • _x000D_ _x000D_ _x000D_
  • 13: Mehrle A, Rosenfelder H, Schupp I, del Val C, Arlt D, Hahne F, Bechtel S,_x000D_ Simpson J, Hofmann O, Hide W, Glatting KH, Huber W, Pepperkok R, Poustka A,_x000D_ Wiemann S. The LIFEdb database in 2006. Nucleic Acids Res. 2006 Jan 1;34(Database_x000D_ issue):D415-8. PubMed PMID: 16381901; PubMed Central PMCID: PMC1347501.
    • _x000D_ _x000D_ _x000D_
  • 14: Wiemann S, Arlt D, Huber W, Wellenreuther R, Schleeger S, Mehrle A, Bechtel_x000D_ S, Sauermann M, Korf U, Pepperkok R, Sültmann H, Poustka A. From ORFeome to_x000D_ biology: a functional genomics pipeline. Genome Res. 2004 Oct;14(10B):2136-44._x000D_ PubMed PMID: 15489336; PubMed Central PMCID: PMC528930.
    • _x000D_ _x000D_ _x000D_
  • 15: Wiemann S, Weil B, Wellenreuther R, Gassenhuber J, Glassl S, Ansorge W,_x000D_ Böcher M, Blöcker H, Bauersachs S, Blum H, Lauber J, Düsterhöft A, Beyer A,_x000D_ Köhrer K, Strack N, Mewes HW, Ottenwälder B, Obermaier B, Tampe J, Heubner D,_x000D_ Wambutt R, Korn B, Klein M, Poustka A. Toward a catalog of human genes and_x000D_ proteins: sequencing and analysis of 500 novel complete protein coding human_x000D_ cDNAs. Genome Res. 2001 Mar;11(3):422-35. PubMed PMID: 11230166; PubMed Central_x000D_ PMCID: PMC311072.

Reviews

There are no reviews yet.

REVIEW YOUR PRODUCT

Be the first to review “Human ID Recombinant Protein”

Your email address will not be published. Required fields are marked *

Related products

Dulaglutide Biosimilar – Anti-Glucagon-like peptide-1 receptor agonist mAb – Research Grade
Biosimilar

Dulaglutide Biosimilar – Anti-Glucagon-like peptide-1 receptor agonist mAb – Research Grade

PX-TA1017 238$
View product
Bamlanivimab Biosimilar – Anti-Covid Spike RBD mAb – Research Grade
Biosimilar

Bamlanivimab Biosimilar – Anti-Covid Spike RBD mAb – Research Grade

PX-TA1031 238$
View product
Tixagevimab Biosimilar – Anti-Covid Spike RBD mAb – Research Grade
Biosimilar

Tixagevimab Biosimilar – Anti-Covid Spike RBD mAb – Research Grade

PX-TA1032 238$
View product
Cilgavimab Biosimilar – Anti-Covid Spike RBD mAb – Research Grade
Biosimilar

Cilgavimab Biosimilar – Anti-Covid Spike RBD mAb – Research Grade

PX-TA1033 238$
View product
14F7 Biosimilar – Anti-ganglioside N-glycolyl GM3 mAb – Research Grade
Biosimilar

14F7 Biosimilar – Anti-ganglioside N-glycolyl GM3 mAb – Research Grade

PX-TA1072 238$
View product
4F2Mab Biosimilar – Anti-ganglioside GD2, SFRP1, SLC3A2 mAb – Research Grade
Biosimilar

4F2Mab Biosimilar – Anti-ganglioside GD2, SFRP1, SLC3A2 mAb – Research Grade

PX-TA1073 238$
View product
Abagovomab Biosimilar – Anti-idiotope of anti-Mus musculus monoclonal antibody OC126 mAb – Research Grade
Biosimilar

Abagovomab Biosimilar – Anti-idiotope of anti-Mus musculus monoclonal antibody OC126 mAb – Research Grade

PX-TA1075 476$
View product
Capromab Biosimilar – Anti-FOLH2 mAb – Research Grade
Biosimilar

Capromab Biosimilar – Anti-FOLH2 mAb – Research Grade

PX-TA1078 238$
View product
Mitumomab Biosimilar – Anti-Ganglioside GD4 mAb – Research Grade
Biosimilar

Mitumomab Biosimilar – Anti-Ganglioside GD4 mAb – Research Grade

PX-TA1090 238$
View product
Satumomab Biosimilar – Anti-TAG-72 mAb – Research Grade
Biosimilar

Satumomab Biosimilar – Anti-TAG-72 mAb – Research Grade

PX-TA1098 238$
View product
Tecnemab Biosimilar – Anti-CSPG4, HMW-MAA, CD3E, ERBB2, toxin mAb – Research Grade
Biosimilar

Tecnemab Biosimilar – Anti-CSPG4, HMW-MAA, CD3E, ERBB2, toxin mAb – Research Grade

PX-TA1100 238$
View product
Bavituximab Biosimilar – Anti-Phosphatidylserine mAb – Research Grade
Biosimilar

Bavituximab Biosimilar – Anti-Phosphatidylserine mAb – Research Grade

PX-TA1107 238$
View product
Clenoliximab Biosimilar – Anti-CD4 mAb – Research Grade
Biosimilar

Clenoliximab Biosimilar – Anti-CD4 mAb – Research Grade

PX-TA1109 238$
View product
Nuclear receptor ROR-alpha(RORA)
Receptor

Nuclear receptor ROR-alpha(RORA)

PX-P4834 217$
View product

Contact us

Send us a message from the form below

    Cart (0 Items)

    Your cart is currently empty.

    View Products