Human ID Recombinant Protein

Reference:
Size

100ug, 50ug

Brand

Product type

Host Species

Applications

,

Product nameHuman ID Recombinant Protein
Uniprot IDQ96NW4
Uniprot linkhttp://www.uniprot.org/uniprot/Q96NW4
Origin speciesHomo sapiens (Human)
Expression systemProkaryotic expression
Sequence(Sequence without tag) MSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYIDGDVKLTQSMAIIRYIADKHN MLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDHVTHPDFMLYDALD VVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIAWPLQGWQATFGGGDHPPKSDLVPRGSSTSSFSSMSASSRQ EETKKDYREVEKLLRAVADGDLEMVRYLLEWTEEDLEDAEDTVSAADPE
Molecular weight33,38 kDa
Protein delivered with Tag?GST
Purity estimated50%
BufferTrisHC 50mMl, pH8
Formliquid
Delivery conditionDry Ice
Delivery lead time in business days10-25
Storage condition4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
BrandProteoGenix
Host speciesEscherichia coli (E.coli)
ApplicationsELISA,WB
Fragment TypePartial
Protein AccessionNP_115515.2
Spec:Entrez GeneID84079
Spec:NCBI Gene AliasesVARP, PP12899
Spec:SwissProtIDQ96NW4
NCBI ReferenceNP_115515.2
Aliases /SynonymsID, ankyrin repeat domain-containing protein 27, ANKRD27, VPS9 domain-containing protein, PP12899
ReferencePX-P1117
NoteFor research use only

Description of Human ID Recombinant Protein

Ankyrin repeat domain-containing protein 27 is a protein that in humans is encoded by the ANKRD27 gene.

Publication

  • 1: Hesketh GG, Pérez-Dorado I, Jackson LP, Wartosch L, Schäfer IB, Gray SR, McCoy AJ, Zeldin OB, Garman EF, Harbour ME, Evans PR, Seaman MN, Luzio JP, Owen DJ. VARP is recruited on to endosomes by direct interaction with retromer, where together they function in export to the cell surface. Dev Cell. 2014 Jun 9;29(5):591-606. doi: 10.1016/j.devcel.2014.04.010. Epub 2014 May 22. PubMed PMID: 24856514; PubMed Central PMCID: PMC4059916.
  • 2: Schäfer IB, Hesketh GG, Bright NA, Gray SR, Pryor PR, Evans PR, Luzio JP, Owen DJ. The binding of Varp to VAMP7 traps VAMP7 in a closed, fusogenically inactive conformation. Nat Struct Mol Biol. 2012 Dec;19(12):1300-9. doi: 10.1038/nsmb.2414. Epub 2012 Oct 28. PubMed PMID: 23104059; PubMed Central PMCID: PMC3605791.
  • 3: Wang F, Zhang H, Zhang X, Wang Y, Ren F, Zhang X, Zhai Y, Chang Z. Varp interacts with Rab38 and functions as its potential effector. Biochem Biophys Res Commun. 2008 Jul 18;372(1):162-7. doi: 10.1016/j.bbrc.2008.05.017. Epub 2008 May 12. PubMed PMID: 18477474.
  • 4: Yatsu A, Shimada H, Ohbayashi N, Fukuda M. Rab40C is a novel Varp-binding protein that promotes proteasomal degradation of Varp in melanocytes. Biol Open. 2015 Feb 6;4(3):267-75. doi: 10.1242/bio.201411114. PubMed PMID: 25661869; PubMed Central PMCID: PMC4359733.
  • 5: Sleiman PM, Wang ML, Cianferoni A, Aceves S, Gonsalves N, Nadeau K, Bredenoord AJ, Furuta GT, Spergel JM, Hakonarson H. GWAS identifies four novel eosinophilic esophagitis loci. Nat Commun. 2014 Nov 19;5:5593. doi: 10.1038/ncomms6593. PubMed PMID: 25407941; PubMed Central PMCID: PMC4238044.
  • 6: Zhang X, He X, Fu XY, Chang Z. Varp is a Rab21 guanine nucleotide exchange factor and regulates endosome dynamics. J Cell Sci. 2006 Mar 15;119(Pt 6):1053-62. PubMed PMID: 16525121.
  • 7: Burgo A, Proux-Gillardeaux V, Sotirakis E, Bun P, Casano A, Verraes A, Liem RK, Formstecher E, Coppey-Moisan M, Galli T. A molecular network for the transport of the TI-VAMP/VAMP7 vesicles from cell center to periphery. Dev Cell. 2012 Jul 17;23(1):166-80. doi: 10.1016/j.devcel.2012.04.019. Epub 2012 Jun 14. PubMed PMID: 22705394.
  • 8: Burgo A, Sotirakis E, Simmler MC, Verraes A, Chamot C, Simpson JC, Lanzetti L, Proux-Gillardeaux V, Galli T. Role of Varp, a Rab21 exchange factor and TI-VAMP/VAMP7 partner, in neurite growth. EMBO Rep. 2009 Oct;10(10):1117-24. doi: 10.1038/embor.2009.186. Epub 2009 Sep 11. PubMed PMID: 19745841; PubMed Central PMCID: PMC2759737.
  • 9: GENDEP Investigators.; MARS Investigators.; STAR*D Investigators.. Common genetic variation and antidepressant efficacy in major depressive disorder: a meta-analysis of three genome-wide pharmacogenetic studies. Am J Psychiatry. 2013 Feb;170(2):207-17. doi: 10.1176/appi.ajp.2012.12020237. PubMed PMID: 23377640.
  • 10: Wan D, Gong Y, Qin W, Zhang P, Li J, Wei L, Zhou X, Li H, Qiu X, Zhong F, He L, Yu J, Yao G, Jiang H, Qian L, Yu Y, Shu H, Chen X, Xu H, Guo M, Pan Z, Chen Y, Ge C, Yang S, Gu J. Large-scale cDNA transfection screening for genes related to cancer development and progression. Proc Natl Acad Sci U S A. 2004 Nov 2;101(44):15724-9. Epub 2004 Oct 21. Erratum in: Proc Natl Acad Sci U S A. 2004 Dec 14:101(50):17565. PubMed PMID: 15498874; PubMed Central PMCID: PMC524842.
  • 11: Simpson JC, Wellenreuther R, Poustka A, Pepperkok R, Wiemann S. Systematic subcellular localization of novel proteins identified by large-scale cDNA sequencing. EMBO Rep. 2000 Sep;1(3):287-92. PubMed PMID: 11256614; PubMed Central PMCID: PMC1083732.
  • 12: Colland F, Jacq X, Trouplin V, Mougin C, Groizeleau C, Hamburger A, Meil A, Wojcik J, Legrain P, Gauthier JM. Functional proteomics mapping of a human signaling pathway. Genome Res. 2004 Jul;14(7):1324-32. PubMed PMID: 15231748; PubMed Central PMCID: PMC442148.
  • 13: Mehrle A, Rosenfelder H, Schupp I, del Val C, Arlt D, Hahne F, Bechtel S, Simpson J, Hofmann O, Hide W, Glatting KH, Huber W, Pepperkok R, Poustka A, Wiemann S. The LIFEdb database in 2006. Nucleic Acids Res. 2006 Jan 1;34(Database issue):D415-8. PubMed PMID: 16381901; PubMed Central PMCID: PMC1347501.
  • 14: Wiemann S, Arlt D, Huber W, Wellenreuther R, Schleeger S, Mehrle A, Bechtel S, Sauermann M, Korf U, Pepperkok R, Sültmann H, Poustka A. From ORFeome to biology: a functional genomics pipeline. Genome Res. 2004 Oct;14(10B):2136-44. PubMed PMID: 15489336; PubMed Central PMCID: PMC528930.
  • 15: Wiemann S, Weil B, Wellenreuther R, Gassenhuber J, Glassl S, Ansorge W, Böcher M, Blöcker H, Bauersachs S, Blum H, Lauber J, Düsterhöft A, Beyer A, Köhrer K, Strack N, Mewes HW, Ottenwälder B, Obermaier B, Tampe J, Heubner D, Wambutt R, Korn B, Klein M, Poustka A. Toward a catalog of human genes and proteins: sequencing and analysis of 500 novel complete protein coding human cDNAs. Genome Res. 2001 Mar;11(3):422-35. PubMed PMID: 11230166; PubMed Central PMCID: PMC311072.

Reviews

There are no reviews yet.

REVIEW YOUR PRODUCT

Be the first to review “Human ID Recombinant Protein”

Your email address will not be published. Required fields are marked *

Related products

Dulaglutide Biosimilar – Anti-Glucagon-like peptide-1 receptor agonist mAb – Research Grade
Biosimilar

Dulaglutide Biosimilar – Anti-Glucagon-like peptide-1 receptor agonist mAb – Research Grade

PX-TA1017 476$
Bamlanivimab Biosimilar – Anti-Covid Spike RBD mAb – Research Grade
Biosimilar

Bamlanivimab Biosimilar – Anti-Covid Spike RBD mAb – Research Grade

PX-TA1031 476$
Tixagevimab Biosimilar – Anti-Covid Spike RBD mAb – Research Grade
Biosimilar

Tixagevimab Biosimilar – Anti-Covid Spike RBD mAb – Research Grade

PX-TA1032 476$
Cilgavimab Biosimilar – Anti-Covid Spike RBD mAb – Research Grade
Biosimilar

Cilgavimab Biosimilar – Anti-Covid Spike RBD mAb – Research Grade

PX-TA1033 357$
14F7 Biosimilar – Anti-ganglioside N-glycolyl GM3 mAb – Research Grade
Biosimilar

14F7 Biosimilar – Anti-ganglioside N-glycolyl GM3 mAb – Research Grade

PX-TA1072 476$
4F2Mab Biosimilar – Anti-ganglioside GD2,  SFRP1, SLC3A2 mAb – Research Grade
Biosimilar

4F2Mab Biosimilar – Anti-ganglioside GD2, SFRP1, SLC3A2 mAb – Research Grade

PX-TA1073 476$
Abagovomab Biosimilar – Anti-idiotope of anti-Mus musculus monoclonal antibody OC126 mAb – Research Grade
Biosimilar

Abagovomab Biosimilar – Anti-idiotope of anti-Mus musculus monoclonal antibody OC126 mAb – Research Grade

PX-TA1075 476$
Capromab Biosimilar – Anti-FOLH2 mAb – Research Grade
Biosimilar

Capromab Biosimilar – Anti-FOLH2 mAb – Research Grade

PX-TA1078 476$
Mitumomab Biosimilar – Anti-Ganglioside GD4 mAb – Research Grade
Biosimilar

Mitumomab Biosimilar – Anti-Ganglioside GD4 mAb – Research Grade

PX-TA1090 476$
Satumomab Biosimilar – Anti-TAG-72 mAb – Research Grade
Biosimilar

Satumomab Biosimilar – Anti-TAG-72 mAb – Research Grade

PX-TA1098 476$
Clostridium perfringens Biosimilar – Anti-CSPG4, HMW-MAA, CD3E, ERBB2, toxin mAb – Research Grade
Biosimilar

Clostridium perfringens Biosimilar – Anti-CSPG4, HMW-MAA, CD3E, ERBB2, toxin mAb – Research Grade

PX-TA1100 476$
Bavituximab Biosimilar – Anti-Phosphatidylserine mAb – Research Grade
Biosimilar

Bavituximab Biosimilar – Anti-Phosphatidylserine mAb – Research Grade

PX-TA1107 476$
Clenoliximab Biosimilar – Anti-CD4 mAb – Research Grade
Biosimilar

Clenoliximab Biosimilar – Anti-CD4 mAb – Research Grade

PX-TA1109 476$
Homo sapiens Biosimilar – Anti-CD80 (B7-1,CD28LG2) mAb – Research Grade
Biosimilar

Homo sapiens Biosimilar – Anti-CD80 (B7-1,CD28LG2) mAb – Research Grade

PX-TA1111 476$
Nuclear receptor ROR-alpha(RORA)
Receptor

Nuclear receptor ROR-alpha(RORA)

PX-P4834 221$

Contact us

Send us a message from the form below







    Cart (0 Items)

    Your cart is currently empty.

    View Products