Cart (0 Items)
Your cart is currently empty.
View Productssize | 100ug, 50ug |
---|---|
Brand | ProteoGenix |
Product type | Recombinant Proteins |
Host Species | Escherichia coli (E. coli) |
Applications | Elisa, WB |
Product name | Human PDCD6IP Recombinant Protein |
---|---|
Uniprot ID | Q8WUM4 |
Uniprot link | http://www.uniprot.org/uniprot/Q8WUM4 |
Origin species | Homo sapiens (Human) |
Expression system | Prokaryotic expression |
Sequence | MATFISVQLKKTSEVDLAKPLVKFIQQTYPSGGEEQAQYCRAAEELSKLRRAAVGRPLDKHEGALETLLRYYDQICSIEPKFPFSENQICLTFTWKDAFDKGSLFGGSVKLALASLGYEKSCVLFNCAALASQIAAEQNLDNDEGLKIAAKHYQFASGAFLHIKETVLSALSREPTVDISPDTVGTLSLIMLAQAQEVFFLKATRDKMKDAIIAKLANQAADYFGDAFKQCQYKDTLPKEVFPVLAAKHCIMQANAEYHQSILAKQQKKFGEEIARLQHAAELIKTVASRYDEYVNVKDFSDKINRALAAAKKDNDFIYHDRVPDLKDLDPIGKATLVKSTPVNVPISQKFTDLFEKMVPVSVQQSLAAYNQRKADLVNRSIAQMREATTLA |
Molecular weight | 44.48 kDa |
Protein delivered with Tag? | Yes |
Purity estimated | 95% |
Buffer | PBS,pH 7.5 |
Form | Frozen |
Delivery condition | Dry Ice |
Delivery lead time in business days | 10-25 |
Storage condition | 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection) |
Brand | ProteoGenix |
Host species | Escherichia coli (E.coli) |
Fragment Type | Partial |
NCBI Reference | Q8WUM4 |
Aliases /Synonyms | PDCD6-IP, AIP1, Alix, DRIP4, HP95, ALG-2 Interacting Protein X,Programmed Cell Death Protein 6 Interacting Protein, PDCD6IP |
Reference | PX-P3047 |
Note | For research use only |
Related products
Send us a message from the form below
Reviews
There are no reviews yet.