Brand: ProteoGenix

Human PDCD6IP Recombinant Protein

PX-P3047-10
Quality Chart

Host species:: Escherichia coli (E.coli)
Origin species:: Homo sapiens (Human)
Uniprot ID:: Q8WUM4
Molecular weight:: 44.48 kDa

$250.00

+ 250 loyalty points

Partial Yes

size size

50ug $250.00
100ug $675.00

Clear

First Name This field is required. Last Name This field is required. Email This field is required. Company This field is required. Country This field is required. State This field is required.

In Stock
Wide range of unique reagents
Fast worldwide delivery

Human PDCD6IP Recombinant Protein

Product name	Human PDCD6IP Recombinant Protein
Uniprot ID	Q8WUM4
Uniprot link	http://www.uniprot.org/uniprot/Q8WUM4
Origin species	Homo sapiens (Human)
Expression system	Prokaryotic expression
Sequence	MATFISVQLKKTSEVDLAKPLVKFIQQTYPSGGEEQAQYCRAAEELSKLRRAAVGRPLDKHEGALETLLRYYDQICSIEPKFPFSENQICLTFTWKDAFDKGSLFGGSVKLALASLGYEKSCVLFNCAALASQIAAEQNLDNDEGLKIAAKHYQFASGAFLHIKETVLSALSREPTVDISPDTVGTLSLIMLAQAQEVFFLKATRDKMKDAIIAKLANQAADYFGDAFKQCQYKDTLPKEVFPVLAAKHCIMQANAEYHQSILAKQQKKFGEEIARLQHAAELIKTVASRYDEYVNVKDFSDKINRALAAAKKDNDFIYHDRVPDLKDLDPIGKATLVKSTPVNVPISQKFTDLFEKMVPVSVQQSLAAYNQRKADLVNRSIAQMREATTLA
Molecular weight	44.48 kDa
Protein delivered with Tag?	Yes
Purity estimated	95%
Buffer	PBS,pH 7.5
Form	Frozen
Delivery condition	Dry Ice
Delivery lead time in business days	10-25
Storage condition	4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand	ProteoGenix
Host species	Escherichia coli (E.coli)
Fragment Type	Partial
NCBI Reference	Q8WUM4
Aliases /Synonyms	PDCD6-IP, AIP1, Alix, DRIP4, HP95, ALG-2 Interacting Protein X,Programmed Cell Death Protein 6 Interacting Protein, PDCD6IP
Reference	PX-P3047
Note	For research use only
Molecular Constructor	Partial Yes

Product name	Human PDCD6IP Recombinant Protein
Uniprot ID	Q8WUM4
Uniprot link	http://www.uniprot.org/uniprot/Q8WUM4
Origin species	Homo sapiens (Human)
Expression system	Prokaryotic expression
Sequence	MATFISVQLKKTSEVDLAKPLVKFIQQTYPSGGEEQAQYCRAAEELSKLRRAAVGRPLDKHEGALETLLRYYDQICSIEPKFPFSENQICLTFTWKDAFDKGSLFGGSVKLALASLGYEKSCVLFNCAALASQIAAEQNLDNDEGLKIAAKHYQFASGAFLHIKETVLSALSREPTVDISPDTVGTLSLIMLAQAQEVFFLKATRDKMKDAIIAKLANQAADYFGDAFKQCQYKDTLPKEVFPVLAAKHCIMQANAEYHQSILAKQQKKFGEEIARLQHAAELIKTVASRYDEYVNVKDFSDKINRALAAAKKDNDFIYHDRVPDLKDLDPIGKATLVKSTPVNVPISQKFTDLFEKMVPVSVQQSLAAYNQRKADLVNRSIAQMREATTLA
Molecular weight	44.48 kDa
Protein delivered with Tag?	Yes
Purity estimated	95%
Buffer	PBS,pH 7.5
Form	Frozen
Delivery condition	Dry Ice
Delivery lead time in business days	10-25
Storage condition	4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand	ProteoGenix
Host species	Escherichia coli (E.coli)
Fragment Type	Partial
NCBI Reference	Q8WUM4
Aliases /Synonyms	PDCD6-IP, AIP1, Alix, DRIP4, HP95, ALG-2 Interacting Protein X,Programmed Cell Death Protein 6 Interacting Protein, PDCD6IP
Reference	PX-P3047
Note	For research use only
Molecular Constructor	Partial Yes

There are no reviews yet.

Be the first to review “Human PDCD6IP Recombinant Protein”

Human PDCD6IP Recombinant Protein

Human PDCD6IP Recombinant Protein

Related products

Pidilizumab Biosimilar – Anti-PDCD1, CD279 mAb – Research Grade

Camrelizumab Biosimilar – Anti-PDCD1, PD-1, CD279 mAb – Research Grade

Gilvetmab Biosimilar – Anti-PDCD1, PD1, CD279 mAb – Research Grade

Tislelizumab Biosimilar – Anti-PDCD1, PD1, CD279 mAb – Research Grade

Spartalizumab Biosimilar – Anti-PDCD1, PD1, CD279 mAb – Research Grade

Cetrelimab Biosimilar – Anti-PDCD1, PD1, CD279 mAb – Research Grade

Budigalimab Biosimilar – Anti-PDCD1, PD1, CD279 mAb – Research Grade

Cemiplimab Biosimilar – Anti-PDCD1, PD1, CD279 mAb – Research Grade

Dostarlimab Biosimilar – Anti-PDCD1, PD1, CD279 mAb – Research Grade

Prolgolimab Biosimilar – Anti-PDCD1, PD1, CD279 mAb – Research Grade

Sintilimab Biosimilar – Anti-PDCD1, PD1, CD279 mAb – Research Grade

Toripalimab Biosimilar – Anti-PDCD1, PD1, CD279 mAb – Research Grade

Balstilimab Biosimilar – Anti-PDCD1, PD1, CD279 mAb – Research Grade

Lodapolimab Biosimilar – Anti-PDCD1, PD-1, CD279 mAb – Research Grade

Recently viewed products

Can’t find what you need?

Cart (0 Items)

Human PDCD6IP Recombinant Protein

Specifications Human PDCD6IP Recombinant Protein

Documents

Reviews

Related products

Pidilizumab Biosimilar – Anti-PDCD1, CD279 mAb – Research Grade

Camrelizumab Biosimilar – Anti-PDCD1, PD-1, CD279 mAb – Research Grade

Gilvetmab Biosimilar – Anti-PDCD1, PD1, CD279 mAb – Research Grade

Tislelizumab Biosimilar – Anti-PDCD1, PD1, CD279 mAb – Research Grade

Spartalizumab Biosimilar – Anti-PDCD1, PD1, CD279 mAb – Research Grade

Cetrelimab Biosimilar – Anti-PDCD1, PD1, CD279 mAb – Research Grade

Budigalimab Biosimilar – Anti-PDCD1, PD1, CD279 mAb – Research Grade

Cemiplimab Biosimilar – Anti-PDCD1, PD1, CD279 mAb – Research Grade

Dostarlimab Biosimilar – Anti-PDCD1, PD1, CD279 mAb – Research Grade

Prolgolimab Biosimilar – Anti-PDCD1, PD1, CD279 mAb – Research Grade

Sintilimab Biosimilar – Anti-PDCD1, PD1, CD279 mAb – Research Grade

Toripalimab Biosimilar – Anti-PDCD1, PD1, CD279 mAb – Research Grade

Balstilimab Biosimilar – Anti-PDCD1, PD1, CD279 mAb – Research Grade

Lodapolimab Biosimilar – Anti-PDCD1, PD-1, CD279 mAb – Research Grade

Recently viewed products

Can’t find what you need?

Cart (0 Items)

Human PDCD6IP Recombinant Protein