Cart (0 Items)
Your cart is currently empty.
View Products
| size | 100ug, 50ug |
|---|---|
| Brand | ProteoGenix |
| Product type | Recombinant Proteins |
| Host Species | Insect |
| Applications | Elisa, WB |
| Product name | Human PSMA Protein: FOLH1 Recombinant Protein |
|---|---|
| Uniprot ID | Q04609 |
| Uniprot link | https://www.uniprot.org/uniprot/Q04609 |
| Origin species | Homo sapiens (Human) |
| Expression system | Eukaryotic expression |
| Sequence | KSSNEATNITPKHNMKAFLDELKAENIKKFLYNFTQIPHLAGTEQNFQLAKQIQSQWKEFGLDSVELAHYDVLLSYPNKTHPNYISIINEDGNEIFNTSLFEPPPPGYENVSDIVPPFSAFSPQGMPEGDLVYVNYARTEDFFKLERDMKINCSGKIVIARYGKVFRGNKVKNAQLAGAKGVILYSDPADYFAPGVKSYPDGWNLPGGGVQRGNILNLNGAGDPLTPGYPANEYAYRRGIAEAVGLPSIPVHPIG |
| Molecular weight | 87.36kDa |
| Protein delivered with Tag? | No |
| Purity estimated | 90% 80% |
| Buffer | PBS, pH 7.5 |
| Form | Frozen |
| Delivery condition | Dry Ice |
| Delivery lead time in business days | 2-3 |
| Storage condition | 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection) |
| Brand | ProteoGenix |
| Host species | Insect |
| Fragment Type | Partial |
| Protein Accession | PDB: 2C6C_A |
| NCBI Reference | 2OOT_A |
| Aliases /Synonyms | Cell growth inhibiting protein 27, Cell growth-inhibiting gene 27 protein, FGCP, Folate hydrolase, Folate hydrolase (prostate-specific membrane antigen) 1, Folate hydrolase 1, Folate hydrolase prostate specific membrane antigen 1, FOLH, FOLH 1, Folh1, FOLH1_HUMAN, Folylpoly gamma glutamate carboxypeptidase, Folylpoly-gamma-glutamate carboxypeptidase, GCP 2, GCP II, GCP2, GCPII, GIG27, Glutamate carboxylase II, Glutamate carboxypeptidase 2, Glutamate carboxypeptidase II, Membrane glutamate carboxypeptidase, mGCP, N acetylated alpha linked acidic dipeptidase 1, N-acetylated-alpha-linked acidic dipeptidase I, NAALAD 1, NAALAD1, NAALAdase, NAALADase I, Prostate specific membrane antigen, Prostate specific membrane antigen variant F, Prostate-specific membrane antigen, PSM, PSMA, Pteroylpoly gamma glutamate carboxypeptidase, Pteroylpoly-gamma-glutamate carboxypeptidase |
| Reference | PX-P2059 |
| Note | For research use only |
Related products
Send us a message from the form below
Reviews
There are no reviews yet.