Skip to main content
Contact +1 (919) 234-1277

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25
Brand: ProteoGenix

Human PSMA Protein: FOLH1 Recombinant Protein

Host species:
Insect
Origin species:
Homo sapiens (Human)
Uniprot ID:
Q04609
Molecular weight:
87.36kDa

$250.00

50ug + 250 loyalty points
Partial No
size
Clear
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery
Human PSMA Protein: FOLH1 Recombinant Protein

Human PSMA Protein: FOLH1 Recombinant Protein

Product name Human PSMA Protein: FOLH1 Recombinant Protein
Uniprot ID Q04609
Uniprot link https://www.uniprot.org/uniprot/Q04609
Origin species Homo sapiens (Human)
Expression system Eukaryotic expression
Sequence KSSNEATNITPKHNMKAFLDELKAENIKKFLYNFTQIPHLAGTEQNFQLAKQIQSQWKEFGLDSVELAHYDVLLSYPNKTHPNYISIINEDGNEIFNTSLFEPPPPGYENVSDIVPPFSAFSPQGMPEGDLVYVNYARTEDFFKLERDMKINCSGKIVIARYGKVFRGNKVKNAQLAGAKGVILYSDPADYFAPGVKSYPDGWNLPGGGVQRGNILNLNGAGDPLTPGYPANEYAYRRGIAEAVGLPSIPVHPIG
Molecular weight 87.36kDa
Protein delivered with Tag? No
Purity estimated 90% 80%
Buffer PBS, pH 7.5
Form Frozen
Delivery condition Dry Ice
Delivery lead time in business days 2-3
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Insect
Fragment Type Partial
Protein Accession PDB: 2C6C_A
NCBI Reference 2OOT_A
Aliases /Synonyms Cell growth inhibiting protein 27, Cell growth-inhibiting gene 27 protein, FGCP, Folate hydrolase, Folate hydrolase (prostate-specific membrane antigen) 1, Folate hydrolase 1, Folate hydrolase prostate specific membrane antigen 1, FOLH, FOLH 1, Folh1, FOLH1_HUMAN, Folylpoly gamma glutamate carboxypeptidase, Folylpoly-gamma-glutamate carboxypeptidase, GCP 2, GCP II, GCP2, GCPII, GIG27, Glutamate carboxylase II, Glutamate carboxypeptidase 2, Glutamate carboxypeptidase II, Membrane glutamate carboxypeptidase, mGCP, N acetylated alpha linked acidic dipeptidase 1, N-acetylated-alpha-linked acidic dipeptidase I, NAALAD 1, NAALAD1, NAALAdase, NAALADase I, Prostate specific membrane antigen, Prostate specific membrane antigen variant F, Prostate-specific membrane antigen, PSM, PSMA, Pteroylpoly gamma glutamate carboxypeptidase, Pteroylpoly-gamma-glutamate carboxypeptidase
Reference PX-P2059
Note For research use only
Molecular Constructor
Partial No
Product name Human PSMA Protein: FOLH1 Recombinant Protein
Uniprot ID Q04609
Uniprot link https://www.uniprot.org/uniprot/Q04609
Origin species Homo sapiens (Human)
Expression system Eukaryotic expression
Sequence KSSNEATNITPKHNMKAFLDELKAENIKKFLYNFTQIPHLAGTEQNFQLAKQIQSQWKEFGLDSVELAHYDVLLSYPNKTHPNYISIINEDGNEIFNTSLFEPPPPGYENVSDIVPPFSAFSPQGMPEGDLVYVNYARTEDFFKLERDMKINCSGKIVIARYGKVFRGNKVKNAQLAGAKGVILYSDPADYFAPGVKSYPDGWNLPGGGVQRGNILNLNGAGDPLTPGYPANEYAYRRGIAEAVGLPSIPVHPIG
Molecular weight 87.36kDa
Protein delivered with Tag? No
Purity estimated 90% 80%
Buffer PBS, pH 7.5
Form Frozen
Delivery condition Dry Ice
Delivery lead time in business days 2-3
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Insect
Fragment Type Partial
Protein Accession PDB: 2C6C_A
NCBI Reference 2OOT_A
Aliases /Synonyms Cell growth inhibiting protein 27, Cell growth-inhibiting gene 27 protein, FGCP, Folate hydrolase, Folate hydrolase (prostate-specific membrane antigen) 1, Folate hydrolase 1, Folate hydrolase prostate specific membrane antigen 1, FOLH, FOLH 1, Folh1, FOLH1_HUMAN, Folylpoly gamma glutamate carboxypeptidase, Folylpoly-gamma-glutamate carboxypeptidase, GCP 2, GCP II, GCP2, GCPII, GIG27, Glutamate carboxylase II, Glutamate carboxypeptidase 2, Glutamate carboxypeptidase II, Membrane glutamate carboxypeptidase, mGCP, N acetylated alpha linked acidic dipeptidase 1, N-acetylated-alpha-linked acidic dipeptidase I, NAALAD 1, NAALAD1, NAALAdase, NAALADase I, Prostate specific membrane antigen, Prostate specific membrane antigen variant F, Prostate-specific membrane antigen, PSM, PSMA, Pteroylpoly gamma glutamate carboxypeptidase, Pteroylpoly-gamma-glutamate carboxypeptidase
Reference PX-P2059
Note For research use only
Molecular Constructor
Partial No

  • Barinka C, Starkova J, Konvalinka J, Lubkowski J. A high-resolution structure of ligand-free human glutamate carboxypeptidase II. Acta Crystallogr Sect F Struct Biol Cryst Commun. 2007 Mar 1;63(Pt 3):150-3. Epub 2007 Feb 13. PubMed PMID: 17329803; PubMed Central PMCID: PMC2330195.

There are no reviews yet.

Be the first to review “Human PSMA Protein: FOLH1 Recombinant Protein”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products