Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Voxalatamab Biosimilar – Anti-PSMA & CD3e mAb – Research Grade

  • PX-TA1757-50
  • Validated ELISA FC WB
Clonality:
Monoclonal Antibody
Isotype:
Ig(G4-kappa_G4-lambda)

Original price was: $213.00.Current price is: $167.00.

50ug 22% OFF + 167 loyalty points
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Voxalatamab Biosimilar - Anti-PSMA & CD3e mAb - Research Grade

Product name Voxalatamab Biosimilar - Anti-PSMA & CD3e mAb - Research Grade
Uniprot ID Q04609 & P07766
Source CAS: 2411871-58-2
Species Humanized
Raw Antigen Sequence MWNLLHETDSAVATARRPRWLCAGALVLAGGFFLLGFLFGWFIKSSNEATNITPKHNMKAFLDELKAENIKKFLYNFTQIPHLAGTEQNFQLAKQIQSQWKEFGLDSVELAHYDVLLSYPNKTHPNYISIINEDGNEIFNTSLFEPPPPGYENVSDIVPPFSAFSPQGMPEGDLVYVNYARTEDFFKLERDMKINCSGKIVIARYGKVFRGNKVKNAQLAGAKGVILYSDPADYFAPGVKSYPDGWNLPGGGVQRGNILNLNGAGDPLTPGYPANEYAYRRGIAEAVGLPSIPVHPIGYYDAQKLLEKMGGSAPPDSSWRGSLKVPYNVGPGFTGNFSTQKVKMHIHSTNEVTRIYNVIGTLRGAVEPDRYVILGGHRDSWVFGGIDPQSGAAVVHEIVRSFGTLKKEGWRPRRTILFASWDAEEFGLLGSTEWAEENSRLLQERGVAYINADSSIEGNYTLRVDCTPLMYSLVHNLTKELKSPDEGFEGKSLYESWTKKSPSPEFSGMPRISKLGSGNDFEVFFQRLGIASGRARYTKNWETNKFSGYPLYHSVYETYELVEKFYDPMFKYHLTVAQVRGGMVFELANSIVLPFDCRDYAVVLRKYADKIYSISMKHPQEMKTYSVSFDSLFSAVKNFTEIASKFSERLQDFDKSNPIVLRMMNDQLMFLERAFIDPLGLPDRPFYRHVIYAPSSHNKYAGESFPGIYDALFDIESKVDPSKAWGEVKRQIYVAAFTVQAAAETLSEVA
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3 week if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB
Aliases /Synonyms Voxalatamab,JNJ-63898081, JNJ-8081,PSMA & CD3e,anti-PSMA & CD3e
Reference PX-TA1757
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype Ig(G4-kappa_G4-lambda)
Clonality Monoclonal Antibody
Product name Voxalatamab Biosimilar - Anti-PSMA & CD3e mAb - Research Grade
Uniprot ID Q04609 & P07766
Source CAS: 2411871-58-2
Species Humanized
Raw Antigen Sequence MWNLLHETDSAVATARRPRWLCAGALVLAGGFFLLGFLFGWFIKSSNEATNITPKHNMKAFLDELKAENIKKFLYNFTQIPHLAGTEQNFQLAKQIQSQWKEFGLDSVELAHYDVLLSYPNKTHPNYISIINEDGNEIFNTSLFEPPPPGYENVSDIVPPFSAFSPQGMPEGDLVYVNYARTEDFFKLERDMKINCSGKIVIARYGKVFRGNKVKNAQLAGAKGVILYSDPADYFAPGVKSYPDGWNLPGGGVQRGNILNLNGAGDPLTPGYPANEYAYRRGIAEAVGLPSIPVHPIGYYDAQKLLEKMGGSAPPDSSWRGSLKVPYNVGPGFTGNFSTQKVKMHIHSTNEVTRIYNVIGTLRGAVEPDRYVILGGHRDSWVFGGIDPQSGAAVVHEIVRSFGTLKKEGWRPRRTILFASWDAEEFGLLGSTEWAEENSRLLQERGVAYINADSSIEGNYTLRVDCTPLMYSLVHNLTKELKSPDEGFEGKSLYESWTKKSPSPEFSGMPRISKLGSGNDFEVFFQRLGIASGRARYTKNWETNKFSGYPLYHSVYETYELVEKFYDPMFKYHLTVAQVRGGMVFELANSIVLPFDCRDYAVVLRKYADKIYSISMKHPQEMKTYSVSFDSLFSAVKNFTEIASKFSERLQDFDKSNPIVLRMMNDQLMFLERAFIDPLGLPDRPFYRHVIYAPSSHNKYAGESFPGIYDALFDIESKVDPSKAWGEVKRQIYVAAFTVQAAAETLSEVA
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3 week if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB,,,
Aliases /Synonyms Voxalatamab,JNJ-63898081, JNJ-8081,PSMA & CD3e,anti-PSMA & CD3e
Reference PX-TA1757
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype Ig(G4-kappa_G4-lambda)
Clonality Monoclonal Antibody
Product name PX-TA1757-50
Uniprot ID Q04609 & P07766
Source CAS: 2411871-58-2
Species Humanized
Raw Antigen Sequence MWNLLHETDSAVATARRPRWLCAGALVLAGGFFLLGFLFGWFIKSSNEATNITPKHNMKAFLDELKAENIKKFLYNFTQIPHLAGTEQNFQLAKQIQSQWKEFGLDSVELAHYDVLLSYPNKTHPNYISIINEDGNEIFNTSLFEPPPPGYENVSDIVPPFSAFSPQGMPEGDLVYVNYARTEDFFKLERDMKINCSGKIVIARYGKVFRGNKVKNAQLAGAKGVILYSDPADYFAPGVKSYPDGWNLPGGGVQRGNILNLNGAGDPLTPGYPANEYAYRRGIAEAVGLPSIPVHPIGYYDAQKLLEKMGGSAPPDSSWRGSLKVPYNVGPGFTGNFSTQKVKMHIHSTNEVTRIYNVIGTLRGAVEPDRYVILGGHRDSWVFGGIDPQSGAAVVHEIVRSFGTLKKEGWRPRRTILFASWDAEEFGLLGSTEWAEENSRLLQERGVAYINADSSIEGNYTLRVDCTPLMYSLVHNLTKELKSPDEGFEGKSLYESWTKKSPSPEFSGMPRISKLGSGNDFEVFFQRLGIASGRARYTKNWETNKFSGYPLYHSVYETYELVEKFYDPMFKYHLTVAQVRGGMVFELANSIVLPFDCRDYAVVLRKYADKIYSISMKHPQEMKTYSVSFDSLFSAVKNFTEIASKFSERLQDFDKSNPIVLRMMNDQLMFLERAFIDPLGLPDRPFYRHVIYAPSSHNKYAGESFPGIYDALFDIESKVDPSKAWGEVKRQIYVAAFTVQAAAETLSEVA
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3 week if production needed
Storage condition store at -80°C
Brand ProteoGenix
Aliases /Synonyms Voxalatamab,JNJ-63898081, JNJ-8081,PSMA & CD3e,anti-PSMA & CD3e
Reference PX-TA1757
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype Ig(G4-kappa_G4-lambda)
Clonality Monoclonal Antibody

Introduction to Voxalatamab Biosimilar – Anti-PSMA & CD3e mAb

Voxalatamab Biosimilar – Anti-PSMA & CD3e mAb is a novel monoclonal antibody that has been developed as a potential therapeutic agent in the treatment of prostate cancer. This biosimilar is designed to target both prostate-specific membrane antigen (PSMA) and CD3e, two important proteins involved in the progression of prostate cancer. In this article, we will discuss the structure, activity, and potential applications of Voxalatamab Biosimilar in the field of cancer research.

Structure of Voxalatamab Biosimilar

Voxalatamab Biosimilar is a chimeric monoclonal antibody, meaning it is composed of both human and mouse components. The antibody is made up of two heavy chains and two light chains, each consisting of variable and constant regions. The variable regions are responsible for binding to the target proteins, PSMA and CD3e, while the constant regions determine the antibody’s effector functions.

Title: Targeting PSMA and CD3e with Voxalatamab Biosimilar

PSMA is a protein that is highly expressed on the surface of prostate cancer cells, making it an ideal target for cancer therapy. CD3e, on the other hand, is a protein found on the surface of T cells, which play a crucial role in the body’s immune response. By targeting both PSMA and CD3e, Voxalatamab Biosimilar aims to activate the body’s immune system to recognize and destroy prostate cancer cells.

Mechanism of Action of Voxalatamab Biosimilar

Once administered, Voxalatamab Biosimilar binds to both PSMA and CD3e on the surface of prostate cancer cells and T cells, respectively. This binding triggers a cascade of events, leading to the activation and proliferation of T cells. These activated T cells then migrate to the site of the tumor and release cytotoxic substances, such as perforin and granzymes, which induce cell death in the cancer cells.

Title: Potential Applications of Voxalatamab Biosimilar

Voxalatamab Biosimilar has shown promising results in preclinical studies and is currently being evaluated in clinical trials for the treatment of prostate cancer. The antibody has the potential to be used as a monotherapy or in combination with other treatments, such as chemotherapy or radiation therapy. Additionally, Voxalatamab Biosimilar may also have applications in other types of cancer that express PSMA and CD3e, such as bladder cancer and ovarian cancer.

Advantages of Voxalatamab Biosimilar

One of the main advantages of Voxalatamab Biosimilar is its ability to target both PSMA and CD3e, which are important proteins involved in the progression of prostate cancer. This dual targeting approach may lead to a more effective and specific treatment compared to traditional therapies. Additionally, as a biosimilar, Voxalatamab Biosimilar is expected to have a lower cost compared to other monoclonal antibodies, making it more accessible to patients.

Conclusion

In summary, Voxalatamab Biosimilar – Anti-PSMA & CD3e mAb is a promising therapeutic agent for the treatment of prostate cancer. Its unique structure and mechanism of action make it a potential game-changer in the field of cancer research. Further studies and clinical trials are needed to fully evaluate the efficacy and safety of this biosimilar, but the initial results are promising. Voxalatamab Biosimilar has the potential to improve the treatment outcomes for patients with prostate cancer and may have applications in other types of cancer as well.

SDS-PAGE for Voxalatamab Biosimilar - Anti-PSMA &, CD3e mAb - Research Grade

SDS-PAGE for Voxalatamab Biosimilar - Anti-PSMA &amp, CD3e mAb - Research Grade

Voxalatamab Biosimilar - Anti-PSMA &, CD3e mAb - Research Grade on SDS-PAGE under reducing and non-reducing conditions. The gel was stained overnight with Coomassie Blue.. The purity of the antibody is greater than 95%.

Flow Cytometry results for Voxalatamab Biosimilar - Anti-PSMA &, CD3e mAb - Research Grade

Flow Cytometry results for Voxalatamab Biosimilar - Anti-PSMA &amp, CD3e mAb - Research Grade

Flow-cytometry using PE anti-human FOLH1 antibody. LNCAP cells were stained with an irrelevant antibody (Blue Histogram) or an PE anti-human FOLH1 monoclonal antibody (Catalog: PX-TA1757, Yellow Histogram) at a concentration of 5 µg/ml for 30 mins at RT. After washing, and cells analysed on a NovoCyte Flow Cytometer.

Voxalatamab Biosimilar - Anti-PSMA & CD3e mAb - Research Grade

There are no reviews yet.

Be the first to review “Voxalatamab Biosimilar – Anti-PSMA & CD3e mAb – Research Grade”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products