Cart (0 Items)
Your cart is currently empty.
View ProductsSize | 100ug, 50ug |
---|---|
Brand | ProteoGenix |
Product type | Recombinant Proteins |
Host Species | Escherichia coli (E. coli) |
Applications | Elisa, WB |
Product name | Human Serum amyloid A-1 protein(SAA1) Recombinant Protein |
---|---|
Uniprot ID | P0DJI8 |
Uniprot link | http://www.uniprot.org/uniprot/P0DJI8 |
Origin species | Homo sapiens (Human) |
Expression system | Prokaryotic expression |
Sequence | MNHKVHHHHHHMRSFFSFLGEAFDGARDMWRAYSDMREANYIGSDKYFHARGNYDAAKRGPGGVWAAEAISDARENIQRFFGHGAEDSLADQAANEWGRSGKDPNHFRPAGLPEKY |
Molecular weight | 13.2 kDa |
Protein delivered with Tag? | Yes |
Purity estimated | 90% |
Buffer | Tris-HC 50mMl, NaCl 150mM, pH7.5 |
Form | Frozen |
Delivery condition | Dry Ice |
Delivery lead time in business days | 5-7 |
Storage condition | 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection) |
Brand | ProteoGenix |
Host species | Escherichia coli (E.coli) |
Fragment Type | Partial |
Spec:NCBI Gene Aliases | SAA1 |
NCBI Reference | P0DJI8 |
Aliases /Synonyms | Serum amyloid A-1 protein, SAA, Amyloid fibril protein AA |
Reference | PX-P3003 |
Note | For research use only |
Related products
Send us a message from the form below
Reviews
There are no reviews yet.