Cart (0 Items)
Your cart is currently empty.
View Productssize | 100ug, 50ug |
---|---|
Brand | ProteoGenix |
Product type | Recombinant Proteins |
Host Species | Mammalian cells |
Applications | Elisa, WB |
Product name | Microfibrillar-associated protein 2(MFAP2) |
---|---|
Uniprot ID | P55001 |
Origin species | Homo sapiens (Human) |
Expression system | Eukaryotic expression |
Sequence | MRAAYLFLLFLPAGLLAQGQYDLDPLPPFPDHVQYTHYSDQIDNPDYYDYQEVTPRPSEEQFQFQSQQQVQQEVIPAPTPEPGNAELEPTEPGPLDCREEQYPCTRLYSIHRPCKQCLNEVCFYSLRRVYVINKEICVRTVCAHEELLRADLCRDKFSKCGVMASSGLCQSVAASCARSCGSCGSHHHHHH |
Protein delivered with Tag? | C-terminal His Tag |
Purity estimated | >90%by SDS-PAGE |
Buffer | PBS, pH7.5 |
Delivery condition | Dry Ice |
Delivery lead time in business days | Europe: 5-7 working days USA & Canada: 7-10 working days Rest of the world: 5-12 working days |
Storage condition | 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection) |
Brand | ProteoGenix |
Host species | Mammalian cells |
Fragment Type | Met1-Cys183 |
Aliases /Synonyms | Microfibril-associated glycoprotein 1,MAGP,MAGP-1,MAGP1 |
Reference | PX-P4659 |
Note | For research use only |
Immobilized Microfibrillar-associated protein 2(MFAP2) (cat. No.PX-P4659) at 0.5µg/mL (100µL/well) can bind to Sibrotuzumab Biosimilar - Anti-FAP mAb (cat. No.PX-TA1203) in indirect ELISA with Goat Anti-Human IgG secondary antibody coupled with HRP measured by OD450
Related products
Send us a message from the form below
Reviews
There are no reviews yet.