Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Acazicolcept Biosimilar – Anti-CD28 fusion protein – Research Grade

  • PX-TA1999-50
  • Validated ELISA
Uniprot ID:
P10747 & Q9Y6W8

Original price was: $201.00.Current price is: $167.00.

50ug 17% OFF + 167 loyalty points
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Acazicolcept Biosimilar - Anti-CD28 fusion protein - Research Grade

Product name Acazicolcept Biosimilar - Anti-CD28 fusion protein - Research Grade
Uniprot ID P10747 & Q9Y6W8
Expression system XtenCHO
Raw Antigen Sequence MLRLLLALNLFPSIQVTGNKILVKQSPMLVAYDNAVNLSCKYSYNLFSREFRASLHKGLDSAVEVCVVYGNYSQQLQVYSKTGFNCDGKLGNESVTFYLQNLYVNQTDIYFCKIEVMYPPPYLDNEKSNGTIIHVKGKHLCPSPLFPGPSKPFWVLVVVGGVLACYSLLVTVAFIIFWVRSKRSRLLHSDYMNMTPRRPGPTRKHYQPYAPPRDFAAYRS
Purity >90% by SDS-PAGE.
Buffer 0.01M PBS, pH 7.4.
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term; -20°C for long term
Brand ProteoGenix
Applications ELISA,WB
Aliases /Synonyms anti-CD28, TP44, T-cell-specific surface glycoprotein CD28, CD278, ICOS, Inducible T-cell costimulator, Activation-inducible lymphocyte immunomediatory molecule, AILIM
Reference PX-TA1999
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype Fusion - [ICOSLG N-terminal fragment (1-122)]2 - IGHG1 Fc (Fragment constant)
Product name Acazicolcept Biosimilar - Anti-CD28 fusion protein - Research Grade
Uniprot ID P10747 & Q9Y6W8
Expression system XtenCHO
Raw Antigen Sequence MLRLLLALNLFPSIQVTGNKILVKQSPMLVAYDNAVNLSCKYSYNLFSREFRASLHKGLDSAVEVCVVYGNYSQQLQVYSKTGFNCDGKLGNESVTFYLQNLYVNQTDIYFCKIEVMYPPPYLDNEKSNGTIIHVKGKHLCPSPLFPGPSKPFWVLVVVGGVLACYSLLVTVAFIIFWVRSKRSRLLHSDYMNMTPRRPGPTRKHYQPYAPPRDFAAYRS
Purity >90% by SDS-PAGE.
Buffer 0.01M PBS, pH 7.4.
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term; -20°C for long term
Brand ProteoGenix
Applications ELISA,WB,,,
Aliases /Synonyms anti-CD28, TP44, T-cell-specific surface glycoprotein CD28, CD278, ICOS, Inducible T-cell costimulator, Activation-inducible lymphocyte immunomediatory molecule, AILIM
Reference PX-TA1999
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype Fusion - [ICOSLG N-terminal fragment (1-122)]2 - IGHG1 Fc (Fragment constant)
Product name PX-TA1999-50
Uniprot ID P10747 & Q9Y6W8
Expression system XtenCHO
Raw Antigen Sequence MLRLLLALNLFPSIQVTGNKILVKQSPMLVAYDNAVNLSCKYSYNLFSREFRASLHKGLDSAVEVCVVYGNYSQQLQVYSKTGFNCDGKLGNESVTFYLQNLYVNQTDIYFCKIEVMYPPPYLDNEKSNGTIIHVKGKHLCPSPLFPGPSKPFWVLVVVGGVLACYSLLVTVAFIIFWVRSKRSRLLHSDYMNMTPRRPGPTRKHYQPYAPPRDFAAYRS
Purity >90% by SDS-PAGE.
Buffer 0.01M PBS, pH 7.4.
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term; -20°C for long term
Brand ProteoGenix
Aliases /Synonyms anti-CD28, TP44, T-cell-specific surface glycoprotein CD28, CD278, ICOS, Inducible T-cell costimulator, Activation-inducible lymphocyte immunomediatory molecule, AILIM
Reference PX-TA1999
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype Fusion - [ICOSLG N-terminal fragment (1-122)]2 - IGHG1 Fc (Fragment constant)

Introduction to Acazicolcept Biosimilar

Acazicolcept Biosimilar, also known as Anti-CD28 fusion protein, is a research grade antibody that has shown promising results in pre-clinical studies as a potential therapeutic target for various diseases. In this article, we will delve into the structure, activity, and potential applications of this novel biosimilar.

Structure of Acazicolcept Biosimilar

Acazicolcept Biosimilar is a fusion protein that combines the extracellular domain of human CD28 receptor with the Fc region of human IgG1 antibody. This fusion protein is produced through recombinant DNA technology, where the gene for CD28 receptor is fused with the gene for IgG1 Fc region. The resulting protein is a monomeric molecule with a molecular weight of approximately 60 kDa.

The CD28 receptor is a co-stimulatory molecule found on the surface of T cells, which plays a crucial role in the activation and proliferation of T cells. The Fc region of IgG1 provides stability to the fusion protein and enables it to bind to Fc receptors on immune cells, further enhancing its activity.

Activity of Acazicolcept Biosimilar

Acazicolcept Biosimilar acts as a potent antagonist of CD28 receptor, thereby inhibiting its co-stimulatory activity. CD28 receptor is known to interact with its ligands, CD80 and CD86, on antigen-presenting cells, leading to the activation and proliferation of T cells. This process is essential for the initiation of an immune response against foreign pathogens. However, in certain diseases, such as autoimmune disorders and transplant rejection, this co-stimulatory activity of CD28 can be detrimental.

Acazicolcept Biosimilar binds to CD28 receptor and prevents its interaction with CD80 and CD86, thereby inhibiting the activation and proliferation of T cells. This mechanism of action makes it a potential therapeutic target for various diseases where the dysregulation of T cell activation is involved.

Applications of Acazicolcept Biosimilar

Acazicolcept Biosimilar has shown promising results in pre-clinical studies as a potential treatment for autoimmune diseases, such as rheumatoid arthritis, multiple sclerosis, and psoriasis. In these diseases, the immune system mistakenly attacks healthy tissues, leading to chronic inflammation and tissue damage. By inhibiting the co-stimulatory activity of CD28, Acazicolcept Biosimilar can potentially reduce the activation and proliferation of autoreactive T cells, thereby suppressing the immune response and reducing inflammation.

Moreover, Acazicolcept Biosimilar has also shown potential in preventing

transplant rejection. In organ transplantation, the recipient’s immune system recognizes the transplanted organ as foreign and mounts an immune response against it. This can lead to organ rejection and failure. By inhibiting the co-stimulatory activity of CD28, Acazicolcept Biosimilar can potentially prevent the activation and proliferation of T cells, thereby reducing the risk of transplant rejection.

In addition to its potential therapeutic applications, Acazicolcept Biosimilar can also be used as a research tool to study the role of CD28 receptor in various diseases and to develop new treatments targeting this pathway.

Conclusion

Acazicolcept Biosimilar, also known as Anti-CD28 fusion protein, is a promising research grade antibody that has shown potential as a therapeutic target for various diseases. Its unique structure and mechanism of action make it a potent antagonist of CD28 receptor, which plays a crucial role in the activation and proliferation of T cells. With further research and clinical trials, Acazicolcept Biosimilar has the potential to become a valuable treatment option for autoimmune diseases and transplant rejection.

Research Grade Acazicolcept binds to Recombinant Mouse CD28 Protein, N-His-SUMO in ELISA Assay

Research Grade Acazicolcept binds to Recombinant Mouse CD28 Protein, N-His-SUMO in ELISA Assay

Recombinant Mouse CD28 Protein, N-His-SUMO(cat. No.ARO-P11085) at 0.5µg/mL (100µL/well) can bind Research Grade Acazicolcept in indirect ELISA with Goat secondary antibody measured by OD450.

SDS-PAGE for Research Grade Acazicolcept

SDS-PAGE for Research Grade Acazicolcept

Research Grade Acazicolcept, on SDS-PAGE. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

Acazicolcept Biosimilar - Anti-CD28 fusion protein - Research Grade

There are no reviews yet.

Be the first to review “Acazicolcept Biosimilar – Anti-CD28 fusion protein – Research Grade”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products