Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Asunercept Biosimilar – Anti-CD95L fusion protein – Research Grade

Uniprot ID:
P48023

Original price was: $205.00.Current price is: $167.00.

50ug 19% OFF + 167 loyalty points
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Asunercept Biosimilar - Anti-CD95L fusion protein - Research Grade

Product name Asunercept Biosimilar - Anti-CD95L fusion protein - Research Grade
Uniprot ID P48023
Expression system XtenCHO
Raw Antigen Sequence MQQPFNYPYPQIYWVDSSASSPWAPPGTVLPCPTSVPRRPGQRRPPPPPPPPPLPPPPPPPPLPPLPLPPLKKRGNHSTGLCLLVMFFMVLVALVGLGLGMFQLFHLQKELAELRESTSQMHTASSLEKQIGHPSPPPEKKELRKVAHLTGKSNSRSMPLEWEDTYGIVLLSGVKYKKGGLVINETGLYFVYSKVYFRGQSCNNLPLSHKVYMRNSKYPQDLVMMEGKMMSYCTTGQMWARSSYLGAVFNLTSADHLYVNVSELSLVNFEESQTFFGLYKL
Purity >90% by SDS-PAGE.
Buffer 0.01M PBS, pH 7.4.
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term; -20°C for long term
Brand ProteoGenix
Applications ELISA,WB
Aliases /Synonyms anti-Receptor-binding FasL ectodomain, APL, APT1LG1, FasL ICD, Fas antigen ligand, CD178, sFasL, CD95L, APTL, TNFSF6, Apoptosis antigen ligand, SPA, FASLG, FasL, SPPL2A-processed FasL form, Tumor necrosis factor ligand superfamily member 6, Soluble Fas ligand, Fas ligand, CD95 ligand, CD95-L, FASL
Reference PX-TA2001
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype Fusion - [FAS (Fas cell surface death receptor, TNFRSF6, tumor necrosis factor receptor (TNFR) superfamily member 6, FAS1, APO-1, CD95)]2 - IGHG1 Fc (Fragment constant)
Product name Asunercept Biosimilar - Anti-CD95L fusion protein - Research Grade
Uniprot ID P48023
Expression system XtenCHO
Raw Antigen Sequence MQQPFNYPYPQIYWVDSSASSPWAPPGTVLPCPTSVPRRPGQRRPPPPPPPPPLPPPPPPPPLPPLPLPPLKKRGNHSTGLCLLVMFFMVLVALVGLGLGMFQLFHLQKELAELRESTSQMHTASSLEKQIGHPSPPPEKKELRKVAHLTGKSNSRSMPLEWEDTYGIVLLSGVKYKKGGLVINETGLYFVYSKVYFRGQSCNNLPLSHKVYMRNSKYPQDLVMMEGKMMSYCTTGQMWARSSYLGAVFNLTSADHLYVNVSELSLVNFEESQTFFGLYKL
Purity >90% by SDS-PAGE.
Buffer 0.01M PBS, pH 7.4.
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term; -20°C for long term
Brand ProteoGenix
Applications ELISA,WB,,,
Aliases /Synonyms anti-Receptor-binding FasL ectodomain, APL, APT1LG1, FasL ICD, Fas antigen ligand, CD178, sFasL, CD95L, APTL, TNFSF6, Apoptosis antigen ligand, SPA, FASLG, FasL, SPPL2A-processed FasL form, Tumor necrosis factor ligand superfamily member 6, Soluble Fas ligand, Fas ligand, CD95 ligand, CD95-L, FASL
Reference PX-TA2001
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype Fusion - [FAS (Fas cell surface death receptor, TNFRSF6, tumor necrosis factor receptor (TNFR) superfamily member 6, FAS1, APO-1, CD95)]2 - IGHG1 Fc (Fragment constant)
Product name PX-TA2001-50
Uniprot ID P48023
Expression system XtenCHO
Raw Antigen Sequence MQQPFNYPYPQIYWVDSSASSPWAPPGTVLPCPTSVPRRPGQRRPPPPPPPPPLPPPPPPPPLPPLPLPPLKKRGNHSTGLCLLVMFFMVLVALVGLGLGMFQLFHLQKELAELRESTSQMHTASSLEKQIGHPSPPPEKKELRKVAHLTGKSNSRSMPLEWEDTYGIVLLSGVKYKKGGLVINETGLYFVYSKVYFRGQSCNNLPLSHKVYMRNSKYPQDLVMMEGKMMSYCTTGQMWARSSYLGAVFNLTSADHLYVNVSELSLVNFEESQTFFGLYKL
Purity >90% by SDS-PAGE.
Buffer 0.01M PBS, pH 7.4.
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term; -20°C for long term
Brand ProteoGenix
Aliases /Synonyms anti-Receptor-binding FasL ectodomain, APL, APT1LG1, FasL ICD, Fas antigen ligand, CD178, sFasL, CD95L, APTL, TNFSF6, Apoptosis antigen ligand, SPA, FASLG, FasL, SPPL2A-processed FasL form, Tumor necrosis factor ligand superfamily member 6, Soluble Fas ligand, Fas ligand, CD95 ligand, CD95-L, FASL
Reference PX-TA2001
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype Fusion - [FAS (Fas cell surface death receptor, TNFRSF6, tumor necrosis factor receptor (TNFR) superfamily member 6, FAS1, APO-1, CD95)]2 - IGHG1 Fc (Fragment constant)

Introduction

Asunercept Biosimilar, also known as Anti-CD95L fusion protein, is a research grade antibody that has shown promising results in the field of immunotherapy. This fusion protein is designed to target and inhibit the activity of CD95L, a protein that plays a critical role in the regulation of cell death. In this article, we will explore the structure, activity, and potential applications of Asunercept Biosimilar.

Structure of Asunercept Biosimilar

Asunercept Biosimilar is a fusion protein that is composed of two different components – a human IgG1-Fc region and a CD95L-binding domain. The human IgG1-Fc region provides stability and prolongs the half-life of the fusion protein, while the CD95L-binding domain is responsible for its specific targeting activity.

The CD95L-binding domain is derived from the extracellular region of the CD95L protein, which is known to interact with its receptor CD95 (also known as Fas). This interaction triggers a signaling cascade that ultimately leads to cell death. By binding to CD95L, Asunercept Biosimilar effectively blocks this signaling pathway and prevents cell death.

Activity of Asunercept Biosimilar

Asunercept Biosimilar has been shown to have potent inhibitory activity against CD95L. In vitro studies have demonstrated that it can effectively block the interaction between CD95L and its receptor CD95, leading to the inhibition of cell death. This activity has also been confirmed in animal studies, where Asunercept Biosimilar was able to protect against CD95L-induced liver damage.

Moreover, Asunercept Biosimilar has been shown to have a synergistic effect when combined with other immunotherapies, such as checkpoint inhibitors. This is due to its ability to modulate the immune response and enhance the activity of other therapeutic agents.

Potential Applications of Asunercept Biosimilar

Asunercept Biosimilar has shown great potential as a therapeutic agent in various disease conditions where CD95L plays a critical role. One of the most promising applications is in the treatment of autoimmune diseases, where CD95L is overexpressed and contributes to tissue damage.

In addition, Asunercept Biosimilar has shown efficacy in cancer treatment. CD95L is known to play a role in tumor growth and metastasis, and by targeting this protein, Asunercept Biosimilar has the potential to inhibit tumor growth and sensitize cancer cells to other therapies.

Furthermore, Asunercept Biosimilar has also shown promise in the treatment of viral infections. CD95L has been found to be upregulated in viral infections, and by inhibiting its activity, Asunercept Biosimilar can potentially reduce viral replication and limit the severity of the infection.

Conclusion

In conclusion, Asunercept Biosimilar is a research grade antibody that has demonstrated potent inhibitory activity against CD95L. Its unique structure and specific targeting activity make it a promising candidate for the treatment of various diseases, including autoimmune diseases, cancer, and viral infections. Further research and clinical trials are needed to fully explore the potential of this fusion protein in the field of immunotherapy.

SDS-PAGE for Research Grade Asunercept

SDS-PAGE for Research Grade Asunercept

Research Grade Asunercept, on SDS-PAGE. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

Asunercept Biosimilar - Anti-CD95L fusion protein - Research Grade

There are no reviews yet.

Be the first to review “Asunercept Biosimilar – Anti-CD95L fusion protein – Research Grade”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products