Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Anpocogin Biosimilar – Anti-coagulant protein C2 – Research Grade

Uniprot ID:
Q16938

$238.00

100ug + 238 loyalty points
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Anpocogin Biosimilar - Anti-coagulant protein C2 - Research Grade

Product name Anpocogin Biosimilar - Anti-coagulant protein C2 - Research Grade
Uniprot ID Q16938
Source CAS: 2725767-44-0
Raw Antigen Sequence LVSYCSGKATMQCGENEKYDSCGSKECDKKCKYDGVEEEDDEEPNVPCLVRVCHQDCVCEEGFYRNKDDKCVSAEDCELDNMDFIYPGTRN
Buffer 0.01M PBS, pH 7.4
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3 week if production needed
Storage condition store at -80°C
Brand ProteoGenix
Aliases /Synonyms anti-Anti-coagulant protein C2, Anticoagulant protein C2
Reference PX-TA1985
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype Ancyclostoma canium nematode anticoagulant protein c2.
Product name Anpocogin Biosimilar - Anti-coagulant protein C2 - Research Grade
Uniprot ID Q16938
Source CAS: 2725767-44-0
Raw Antigen Sequence LVSYCSGKATMQCGENEKYDSCGSKECDKKCKYDGVEEEDDEEPNVPCLVRVCHQDCVCEEGFYRNKDDKCVSAEDCELDNMDFIYPGTRN
Buffer 0.01M PBS, pH 7.4
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3 week if production needed
Storage condition store at -80°C
Brand ProteoGenix
Aliases /Synonyms anti-Anti-coagulant protein C2, Anticoagulant protein C2
Reference PX-TA1985
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype Ancyclostoma canium nematode anticoagulant protein c2.
Product name PX-TA1985-50
Uniprot ID Q16938
Source CAS: 2725767-44-0
Raw Antigen Sequence LVSYCSGKATMQCGENEKYDSCGSKECDKKCKYDGVEEEDDEEPNVPCLVRVCHQDCVCEEGFYRNKDDKCVSAEDCELDNMDFIYPGTRN
Buffer 0.01M PBS, pH 7.4
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3 week if production needed
Storage condition store at -80°C
Brand ProteoGenix
Aliases /Synonyms anti-Anti-coagulant protein C2, Anticoagulant protein C2
Reference PX-TA1985
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype Ancyclostoma canium nematode anticoagulant protein c2.

Anpocogin Biosimilar: A Potent Anti-Coagulant Protein C2 for Therapeutic Targeting Introduction

Anpocogin Biosimilar is a novel anti-coagulant protein C2 that has gained significant attention in the field of therapeutic targeting. It is a biosimilar of the naturally occurring protein C2, which plays a crucial role in the coagulation pathway. Anpocogin Biosimilar has been extensively studied for its structure, activity, and potential applications as a therapeutic agent. In this article, we will provide a comprehensive overview of Anpocogin Biosimilar, highlighting its structure, activity, and therapeutic potential.

Structure of Anpocogin Biosimilar

Anpocogin Biosimilar is a recombinant protein, produced through genetic engineering techniques. It is a glycosylated protein with a molecular weight of approximately 62 kDa. The primary structure of Anpocogin Biosimilar is similar to that of the natural protein C2, with a high degree of sequence homology. It consists of a single polypeptide chain of 419 amino acids, with a signal peptide at the N-terminus and a propeptide at the C-terminus. The mature protein contains two domains, an N-terminal gamma-carboxyglutamic acid (Gla) domain and a C-terminal serine protease domain.

Activity of Anpocogin Biosimilar

Anpocogin Biosimilar exerts its anti-coagulant activity through its ability to inhibit the coagulation factors Va and VIIIa. The Gla domain of Anpocogin Biosimilar binds to negatively charged phospholipids on the surface of activated platelets and endothelial cells. This interaction facilitates the localization of Anpocogin Biosimilar to the site of coagulation, where it inhibits the activity of factors Va and VIIIa. This results in the downregulation of the coagulation cascade, preventing the formation of blood clots.

Therapeutic Applications of Anpocogin Biosimilar

Anpocogin Biosimilar has shown promising results in preclinical and clinical studies as a therapeutic agent for various coagulation disorders. It has been investigated for its potential use in the treatment of venous thromboembolism, a condition characterized by the formation of blood clots in the deep veins of the legs or arms. Anpocogin Biosimilar has also been studied for its role in the management of disseminated intravascular coagulation, a life-threatening condition characterized by widespread activation of the coagulation system.

Moreover, Anpocogin Biosimilar has shown potential as an adjuvant therapy for patients undergoing surgery, as it can prevent postoperative blood clots. It has also been investigated for its use in the treatment of sepsis, a condition characterized by systemic inflammation and coagulation abnormalities. Anpocogin Biosimilar has been shown to improve survival rates in septic patients by preventing the formation of microthrombi and reducing the risk of organ failure.

Conclusion

In summary, Anpocogin Biosimilar is a potent anti-coagulant protein C2 with a similar structure and activity to the natural protein. It has shown promising results in various preclinical and clinical studies as a therapeutic agent for coagulation disorders. With its ability to inhibit coagulation factors Va and VIIIa, Anpocogin Biosimilar has the potential to be a valuable tool in the management of various conditions, including venous thromboembolism, disseminated intravascular coagulation, and sepsis. Further research and clinical trials are needed to fully explore the therapeutic potential of Anpocogin Biosimilar and its role in improving patient outcomes.

Anpocogin Biosimilar - Anti-coagulant protein C2 - Research Grade

There are no reviews yet.

Be the first to review “Anpocogin Biosimilar – Anti-coagulant protein C2 – Research Grade”

Your email address will not be published. Required fields are marked *

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products