Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Zalfermin Biosimilar – Anti-FGF21 mAb – Research Grade

Uniprot ID:
Q9NSA1

Original price was: $207.00.Current price is: $167.00.

50ug 19% OFF + 167 loyalty points
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Zalfermin Biosimilar - Anti-FGF21 mAb - Research Grade

Product name PX-TA2163-50
Uniprot ID Q9NSA1
Source CAS: 1958040-66-8
Expression system XtenCHO
Raw Antigen Sequence MDSDETGFEHSGLWVSVLAGLLLGACQAHPIPDSSPLLQFGGQVRQRYLYTDDAQQTEAHLEIREDGTVGGAADQSPESLLQLKALKPGVIQILGVKTSRFLCQRPDGALYGSLHFDPEACSFRELLLEDGYNVYQSEAHGLPLHLPGNKSPHRDPAPRGPARFLPLPGLPPALPEPPGILAPQPPDVGSSDPLSMVGPSQGRSPSYAS
Purity >95% by SDS-PAGE.
Buffer 0.01M PBS, pH 7.4.
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term; -20°C for long term
Brand ProteoGenix
Reference PX-TA2163
Note For research use only. Not suitable for human use.
Isotype Human FGF21
Product name Zalfermin Biosimilar - Anti-FGF21 mAb - Research Grade
Uniprot ID Q9NSA1
Source CAS: 1958040-66-8
Expression system XtenCHO
Raw Antigen Sequence MDSDETGFEHSGLWVSVLAGLLLGACQAHPIPDSSPLLQFGGQVRQRYLYTDDAQQTEAHLEIREDGTVGGAADQSPESLLQLKALKPGVIQILGVKTSRFLCQRPDGALYGSLHFDPEACSFRELLLEDGYNVYQSEAHGLPLHLPGNKSPHRDPAPRGPARFLPLPGLPPALPEPPGILAPQPPDVGSSDPLSMVGPSQGRSPSYAS
Purity >95% by SDS-PAGE.
Buffer 0.01M PBS, pH 7.4.
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term; -20°C for long term
Brand ProteoGenix
Reference PX-TA2163
Note For research use only. Not suitable for human use.
Isotype Human FGF21
Product name Zalfermin Biosimilar - Anti-FGF21 mAb - Research Grade
Uniprot ID Q9NSA1
Source CAS: 1958040-66-8
Expression system XtenCHO
Raw Antigen Sequence MDSDETGFEHSGLWVSVLAGLLLGACQAHPIPDSSPLLQFGGQVRQRYLYTDDAQQTEAHLEIREDGTVGGAADQSPESLLQLKALKPGVIQILGVKTSRFLCQRPDGALYGSLHFDPEACSFRELLLEDGYNVYQSEAHGLPLHLPGNKSPHRDPAPRGPARFLPLPGLPPALPEPPGILAPQPPDVGSSDPLSMVGPSQGRSPSYAS
Purity >95% by SDS-PAGE.
Buffer 0.01M PBS, pH 7.4.
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term; -20°C for long term
Brand ProteoGenix
Reference PX-TA2163
Note For research use only. Not suitable for human use.
Isotype Human FGF21

Zalfermin Biosimilar: A Promising Therapeutic Antibody Targeting FGF21 Introduction

Zalfermin Biosimilar, also known as Anti-FGF21 mAb, is a research-grade monoclonal antibody that has shown promising potential as a therapeutic agent in various diseases. This antibody specifically targets the fibroblast growth factor 21 (FGF21) protein, which plays a crucial role in metabolic regulation and energy homeostasis. In this article, we will delve into the structure, activity and potential applications of Zalfermin Biosimilar, highlighting its significance as a therapeutic antibody.

Structure of Zalfermin Biosimilar

Zalfermin Biosimilar is a recombinant monoclonal antibody that is produced using advanced biotechnology techniques. It is composed of two heavy chains and two light chains, linked together by disulfide bonds. The heavy chains consist of constant and variable regions, while the light chains have only variable regions. The variable regions of the antibody are responsible for binding to the target protein, FGF21, with high specificity and affinity.

Activity of Zalfermin Biosimilar

FGF21 is a hormone-like protein that is primarily produced in the liver and plays a crucial role in regulating glucose and lipid metabolism. It exerts its effects by binding to specific receptors on target cells, including adipocytes, hepatocytes, and skeletal muscle cells. However, in various metabolic disorders, such as obesity and type 2 diabetes, FGF21 signaling is dysregulated, leading to metabolic dysfunction.

Zalfermin Biosimilar acts by binding to FGF21 and blocking its interaction with its receptors, thereby inhibiting its activity. This results in a decrease in glucose and lipid levels, as well as improved insulin sensitivity. Additionally, Zalfermin Biosimilar has been shown to have anti-inflammatory effects, which further contributes to its therapeutic potential.

Applications of Zalfermin Biosimilar

Based on its mechanism of action, Zalfermin Biosimilar has potential applications in various diseases, including obesity, type 2 diabetes, and non-alcoholic fatty liver disease (NAFLD). In preclinical studies, Zalfermin Biosimilar has been shown to improve glucose and lipid metabolism, reduce body weight, and improve insulin sensitivity in animal models of obesity and diabetes. It has also shown promising results in reducing liver fat and inflammation in NAFLD.

Furthermore, FGF21 has been implicated in the regulation of energy expenditure and body weight, making Zalfermin Biosimilar a potential treatment for obesity. In a clinical trial, Zalfermin Biosimilar was found to significantly reduce body weight in obese individuals, with minimal side effects.

Apart from metabolic disorders, FGF21 has also been linked to other diseases, such as cardiovascular diseases and certain cancers. Zalfermin Biosimilar has shown potential in reducing atherosclerotic plaque formation and improving cardiac function in animal models of cardiovascular diseases. It has also demonstrated anti-tumor effects in preclinical studies, making it a potential candidate for cancer therapy.

Conclusion

Zalfermin Biosimilar, a research-grade monoclonal antibody targeting FGF21, has shown promising potential as a therapeutic agent in various diseases. Its unique mechanism of action, targeting the FGF21 protein, makes it a promising candidate for the treatment of metabolic disorders, obesity, cardiovascular diseases, and cancer. Further clinical trials are needed to fully explore the therapeutic potential of Zalfermin Biosimilar and bring it to the market as a novel and effective treatment option.

Zalfermin Biosimilar - Anti-FGF21 mAb - Research Grade

There are no reviews yet.

Be the first to review “Zalfermin Biosimilar – Anti-FGF21 mAb – Research Grade”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products