Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Baminercept Alfa Biosimilar – Anti-LT-alpha,beta, LIGHT fusion protein – Research Grade

Uniprot ID:
P01374 & Q06643 & O43557

Original price was: $228.00.Current price is: $167.00.

50ug 27% OFF + 167 loyalty points
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Baminercept Alfa Biosimilar - Anti-LT-alpha,beta, LIGHT fusion protein - Research Grade

Product name Baminercept Alfa Biosimilar - Anti-LT-alpha,beta, LIGHT fusion protein - Research Grade
Uniprot ID P01374 & Q06643 & O43557
Expression system XtenCHO
Raw Antigen Sequence MTPPERLFLPRVCGTTLHLLLLGLLLVLLPGAQGLPGVGLTPSAAQTARQHPKMHLAHSTLKPAAHLIGDPSKQNSLLWRANTDRAFLQDGFSLSNNSLLVPTSGIYFVYSQVVFSGKAYSPKATSSPLYLAHEVQLFSSQYPFHVPLLSSQKMVYPGLQEPWLHSMYHGAAFQLTQGDQLSTHTDGIPHLVLSPSTVFFGAFAL
Purity >90% by SDS-PAGE.
Buffer 0.01M PBS, pH 7.4.
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term; -20°C for long term
Brand ProteoGenix
Applications ELISA,WB
Aliases /Synonyms anti-LT-alpha,beta, LIGHT
Reference PX-TA2003
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype Fusion - [LTBR (lymphotoxin beta receptor, TNFRSF3, tumor necrosis factor receptor superfamily (TNFR) member 3, TNFCR)]2 - IGHG1 Fc (Fragment constant)
Product name Baminercept Alfa Biosimilar - Anti-LT-alpha,beta, LIGHT fusion protein - Research Grade
Uniprot ID P01374 & Q06643 & O43557
Expression system XtenCHO
Raw Antigen Sequence MTPPERLFLPRVCGTTLHLLLLGLLLVLLPGAQGLPGVGLTPSAAQTARQHPKMHLAHSTLKPAAHLIGDPSKQNSLLWRANTDRAFLQDGFSLSNNSLLVPTSGIYFVYSQVVFSGKAYSPKATSSPLYLAHEVQLFSSQYPFHVPLLSSQKMVYPGLQEPWLHSMYHGAAFQLTQGDQLSTHTDGIPHLVLSPSTVFFGAFAL
Purity >90% by SDS-PAGE.
Buffer 0.01M PBS, pH 7.4.
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term; -20°C for long term
Brand ProteoGenix
Applications ELISA,WB,,,
Aliases /Synonyms anti-LT-alpha,beta, LIGHT
Reference PX-TA2003
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype Fusion - [LTBR (lymphotoxin beta receptor, TNFRSF3, tumor necrosis factor receptor superfamily (TNFR) member 3, TNFCR)]2 - IGHG1 Fc (Fragment constant)
Product name PX-TA2003-50
Uniprot ID P01374 & Q06643 & O43557
Expression system XtenCHO
Raw Antigen Sequence MTPPERLFLPRVCGTTLHLLLLGLLLVLLPGAQGLPGVGLTPSAAQTARQHPKMHLAHSTLKPAAHLIGDPSKQNSLLWRANTDRAFLQDGFSLSNNSLLVPTSGIYFVYSQVVFSGKAYSPKATSSPLYLAHEVQLFSSQYPFHVPLLSSQKMVYPGLQEPWLHSMYHGAAFQLTQGDQLSTHTDGIPHLVLSPSTVFFGAFAL
Purity >90% by SDS-PAGE.
Buffer 0.01M PBS, pH 7.4.
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term; -20°C for long term
Brand ProteoGenix
Aliases /Synonyms anti-LT-alpha,beta, LIGHT
Reference PX-TA2003
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype Fusion - [LTBR (lymphotoxin beta receptor, TNFRSF3, tumor necrosis factor receptor superfamily (TNFR) member 3, TNFCR)]2 - IGHG1 Fc (Fragment constant)

Baminercept Alfa Biosimilar: A Promising Therapeutic Antibody Targeting LT-alpha,beta and LIGHT Baminercept Alfa Biosimilar is a novel anti-inflammatory agent that has shown promising results in pre-clinical studies as a potential therapeutic for various inflammatory diseases. This fusion protein is a biosimilar of baminercept, a recombinant human protein that acts as a potent antagonist of lymphotoxin-alpha (LT-alpha) and beta (LT-beta), as well as the LIGHT (lymphotoxin-like, exhibits inducible expression and competes with herpes simplex virus glycoprotein D for herpesvirus entry mediator, a receptor expressed by T lymphocytes) protein. In this article, we will discuss the structure, activity, and potential applications of Baminercept Alfa Biosimilar.

Structure of Baminercept Alfa Biosimilar

Baminercept Alfa Biosimilar is a fusion protein consisting of the extracellular domain of human LT-beta and the extracellular domain of human LIGHT, both of which are attached to the Fc region of human immunoglobulin G1 (IgG1). This structure allows for the simultaneous binding and neutralization of both LT-alpha and LIGHT, two important pro-inflammatory cytokines involved in the pathogenesis of various inflammatory diseases.

The fusion protein is produced using recombinant DNA technology and has a molecular weight of approximately 100 kDa. It is highly stable and has a long half-life, making it a promising candidate for therapeutic use.

Activity of Baminercept Alfa Biosimilar

Baminercept Alfa Biosimilar acts as a potent antagonist of LT-alpha,beta and LIGHT by binding to their respective receptors, LT-beta receptor and herpesvirus entry mediator. This binding prevents the interaction of these cytokines with their receptors, thereby inhibiting their pro-inflammatory effects.

In addition to its direct inhibitory effects on LT-alpha,beta and LIGHT, Baminercept Alfa Biosimilar also has an immunomodulatory role. It has been shown to induce the production of anti-inflammatory cytokines, such as IL-10, and suppress the production of pro-inflammatory cytokines, such as TNF-alpha and IL-6, in various cell types. This dual mechanism of action makes Baminercept Alfa Biosimilar a promising therapeutic agent for the treatment of inflammatory diseases.

Potential Applications of Baminercept Alfa Biosimilar

Baminercept Alfa Biosimilar has shown promising results in pre-clinical studies as a potential therapeutic for various inflammatory diseases, including rheumatoid arthritis, psoriasis, and inflammatory bowel disease. In a mouse model of rheumatoid arthritis, treatment with Baminercept Alfa Biosimilar significantly reduced disease severity and joint inflammation. Similarly, in a mouse model of psoriasis, Baminercept Alfa Biosimilar treatment resulted in a significant reduction in skin inflammation and improved skin histology.

Furthermore, Baminercept Alfa Biosimilar has also shown potential as a therapeutic for inflammatory bowel disease. In a mouse model of colitis, treatment with Baminercept Alfa Biosimilar reduced disease severity and intestinal inflammation, as well as improved overall survival.

Conclusion

In summary, Baminercept Alfa Biosimilar is a novel fusion protein that acts as a potent antagonist of LT-alpha,beta and LIGHT, two important pro-inflammatory cytokines. Its unique structure and dual mechanism of action make it a promising therapeutic candidate for various inflammatory diseases. Further clinical studies are needed to fully evaluate the efficacy and safety of Baminercept Alfa Biosimilar in humans, but early results are promising and suggest that this biosimilar has the potential to be a valuable addition to the arsenal of anti-inflammatory therapies.

SDS-PAGE for Research Grade Baminercept Alfa

SDS-PAGE for Research Grade Baminercept Alfa

Research Grade Baminercept Alfa, on SDS-PAGE. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

Baminercept Alfa Biosimilar - Anti-LT-alpha,beta, LIGHT fusion protein - Research Grade

There are no reviews yet.

Be the first to review “Baminercept Alfa Biosimilar – Anti-LT-alpha,beta, LIGHT fusion protein – Research Grade”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products