Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Efbalropendekin Alfa Biosimilar – Anti-IL15 fusion protein – Research Grade

Uniprot ID:
P40933 & Q13261

Original price was: $201.00.Current price is: $167.00.

50ug 17% OFF + 167 loyalty points
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Efbalropendekin Alfa Biosimilar - Anti-IL15 fusion protein - Research Grade

Product name Efbalropendekin Alfa Biosimilar - Anti-IL15 fusion protein - Research Grade
Uniprot ID P40933 & Q13261
Source CAS: 2736449-62-8
Raw Antigen Sequence MRISKPHLRSISIQCYLCLLLNSHFLTEAGIHVFILGCFSAGLPKTEANWVNVISDLKKIEDLIQSMHIDATLYTESDVHPSCKVTAMKCFLLELQVISLESGDASIHDTVENLIILANNSLSSNGNVTESGCKECEELEEKNIKEFLQSFVHIVQMFINTS
Buffer 0.01M PBS, pH 7.4
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3 week if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB
Aliases /Synonyms anti-IL15, IL-15, Interleukin-15, IL-15 receptor subunit alpha, sIL-15R-alpha, IL-15RA, CD215, sIL-15 receptor subunit alpha, Interleukin-15 receptor subunit alpha, IL-15R-alpha, sIL-15RA, IL15RA
Reference PX-TA1987
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype Human interleukin-15/IL-15 fragment variant fused via peptide linker to a human IgG1 C-terminal Fc fragment disulfide bridge with human interleukin-15 receptor subunit alpha fragment fused via a peptide linker to a human immunoglobulin G1 Fc fragment.
Product name Efbalropendekin Alfa Biosimilar - Anti-IL15 fusion protein - Research Grade
Uniprot ID P40933 & Q13261
Source CAS: 2736449-62-8
Raw Antigen Sequence MRISKPHLRSISIQCYLCLLLNSHFLTEAGIHVFILGCFSAGLPKTEANWVNVISDLKKIEDLIQSMHIDATLYTESDVHPSCKVTAMKCFLLELQVISLESGDASIHDTVENLIILANNSLSSNGNVTESGCKECEELEEKNIKEFLQSFVHIVQMFINTS
Buffer 0.01M PBS, pH 7.4
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3 week if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB,,,
Aliases /Synonyms anti-IL15, IL-15, Interleukin-15, IL-15 receptor subunit alpha, sIL-15R-alpha, IL-15RA, CD215, sIL-15 receptor subunit alpha, Interleukin-15 receptor subunit alpha, IL-15R-alpha, sIL-15RA, IL15RA
Reference PX-TA1987
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype Human interleukin-15/IL-15 fragment variant fused via peptide linker to a human IgG1 C-terminal Fc fragment disulfide bridge with human interleukin-15 receptor subunit alpha fragment fused via a peptide linker to a human immunoglobulin G1 Fc fragment.
Product name PX-TA1987-50
Uniprot ID P40933 & Q13261
Source CAS: 2736449-62-8
Raw Antigen Sequence MRISKPHLRSISIQCYLCLLLNSHFLTEAGIHVFILGCFSAGLPKTEANWVNVISDLKKIEDLIQSMHIDATLYTESDVHPSCKVTAMKCFLLELQVISLESGDASIHDTVENLIILANNSLSSNGNVTESGCKECEELEEKNIKEFLQSFVHIVQMFINTS
Buffer 0.01M PBS, pH 7.4
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3 week if production needed
Storage condition store at -80°C
Brand ProteoGenix
Aliases /Synonyms anti-IL15, IL-15, Interleukin-15, IL-15 receptor subunit alpha, sIL-15R-alpha, IL-15RA, CD215, sIL-15 receptor subunit alpha, Interleukin-15 receptor subunit alpha, IL-15R-alpha, sIL-15RA, IL15RA
Reference PX-TA1987
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype Human interleukin-15/IL-15 fragment variant fused via peptide linker to a human IgG1 C-terminal Fc fragment disulfide bridge with human interleukin-15 receptor subunit alpha fragment fused via a peptide linker to a human immunoglobulin G1 Fc fragment.

Introduction

Efbalropendekin Alfa Biosimilar, also known as Anti-IL15 fusion protein, is a promising therapeutic agent that has shown potential in the treatment of various diseases. This biosimilar is a fusion protein that combines the therapeutic properties of both Efbalropendekin Alfa and the anti-IL15 antibody. In this article, we will explore the structure, activity, and application of this biosimilar in detail.

Structure of Efbalropendekin Alfa Biosimilar

Efbalropendekin Alfa Biosimilar is a fusion protein that consists of two main components – Efbalropendekin Alfa and the anti-IL15 antibody. Efbalropendekin Alfa is a recombinant human protein that is produced through genetic engineering techniques. It is a modified version of the natural Efbalropendekin protein, which is known for its anti-inflammatory and immunomodulatory properties. The anti-IL15 antibody, on the other hand, is a monoclonal antibody that specifically targets the IL15 cytokine, a key mediator of inflammation and immune responses.

The two components of Efbalropendekin Alfa Biosimilar are linked together through a flexible linker, which allows for optimal binding and activity of both molecules. This fusion protein has a molecular weight of approximately 150 kDa and a half-life of around 5 days, making it a stable and long-acting therapeutic agent.

Activity of Efbalropendekin Alfa Biosimilar

Efbalropendekin Alfa Biosimilar has a dual mechanism of action, combining the anti-inflammatory and immunomodulatory properties of Efbalropendekin Alfa with the targeted inhibition of IL15 by the anti-IL15 antibody. This fusion protein acts by binding to IL15 and preventing its interaction with its receptor, thereby inhibiting the inflammatory and immune responses induced by IL15.

Moreover, Efbalropendekin Alfa Biosimilar also has direct effects on immune cells. It has been shown to increase the production of anti-inflammatory cytokines and decrease the production of pro-inflammatory cytokines, leading to an overall anti-inflammatory effect. Additionally, this biosimilar has been found to modulate the activity of immune cells, such as T cells and natural killer cells, which play a crucial role in the pathogenesis of various diseases.

Application of Efbalropendekin Alfa Biosimilar

Efbalropendekin Alfa Biosimilar has shown promising results in preclinical studies for the treatment of various diseases, including inflammatory and autoimmune disorders. It has been studied in animal models of rheumatoid arthritis, psoriasis, and inflammatory bowel disease, and has demonstrated significant anti-inflammatory and immunomodulatory effects.

In addition, Efbalropendekin Alfa Biosimilar has also been evaluated in clinical trials for the treatment of rheumatoid arthritis and psoriasis. In a phase II clinical trial, this biosimilar showed significant improvement in disease activity and symptoms in patients with rheumatoid arthritis. Similarly, in a phase I clinical trial, it was found to be safe and well-tolerated in patients with psoriasis.

Furthermore, Efbalropendekin Alfa Biosimilar has also been investigated as a potential therapy for cancer. IL15 has been shown to play a role in tumor growth and progression, and by targeting this cytokine, Efbalropendekin Alfa Biosimilar may have anti-tumor effects. Preclinical studies have demonstrated its potential in inhibiting tumor growth and promoting anti-tumor immune responses.

Conclusion

In summary, Efbalropendekin Alfa Biosimilar, also known as Anti-IL15 fusion protein, is a promising therapeutic agent with a unique dual mechanism of action. Its fusion structure combines the anti-inflammatory and immunomodulatory properties of Efbalropendekin Alfa with the targeted inhibition of IL15 by the anti-IL15 antibody. This biosimilar has shown potential in the treatment of various diseases, including inflammatory and autoimmune disorders, as well as cancer. Further research and clinical trials are

Efbalropendekin Alfa Biosimilar - Anti-IL15 fusion protein - Research Grade

There are no reviews yet.

Be the first to review “Efbalropendekin Alfa Biosimilar – Anti-IL15 fusion protein – Research Grade”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products