Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Brenetafusp Biosimilar – Anti-HLAA fusion protein – Research Grade

Uniprot ID:
P04439 & P07766

Original price was: $209.00.Current price is: $167.00.

50ug 20% OFF + 167 loyalty points
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Brenetafusp Biosimilar - Anti-HLAA fusion protein - Research Grade

Product name Brenetafusp Biosimilar - Anti-HLAA fusion protein - Research Grade
Uniprot ID P04439 & P07766
Source CAS: 2736407-54-6
Raw Antigen Sequence MAVMAPRTLLLLLSGALALTQTWAGSHSMRYFFTSVSRPGRGEPRFIAVGYVDDTQFVRFDSDAASQRMEPRAPWIEQEGPEYWDQETRNVKAQSQTDRVDLGTLRGYYNQSEAGSHTIQIMYGCDVGSDGRFLRGYRQDAYDGKDYIALNEDLRSWTAADMAAQITKRKWEAAHEAEQLRAYLDGTCVEWLRRYLENGKETLQRTDPPKTHMTHHPISDHEATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDGTFQKWAAVVVPSGEEQRYTCHVQHEGLPKPLTLRWELSSQPTIPIVGIIAGLVLLGAVITGAVVAAVMWRRKSSDRKGGSYTQAASSDSAQGSDVSLTACKV
Buffer 0.01M PBS, pH 7.4
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3 week if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB
Aliases /Synonyms anti-HLAA, Human leukocyte antigen A, HLA class I histocompatibility antigen, A alpha chain, HLA-A, T3E, T-cell surface antigen T3/Leu-4 epsilon chain, CD3e, CD3E, T-cell surface glycoprotein CD3 epsilon chain
Reference PX-TA1984
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype scFv - fused to a human T-cell receptor beta chain disulfide bridged to a human T cell receptor alpha chain.
Product name Brenetafusp Biosimilar - Anti-HLAA fusion protein - Research Grade
Uniprot ID P04439 & P07766
Source CAS: 2736407-54-6
Raw Antigen Sequence MAVMAPRTLLLLLSGALALTQTWAGSHSMRYFFTSVSRPGRGEPRFIAVGYVDDTQFVRFDSDAASQRMEPRAPWIEQEGPEYWDQETRNVKAQSQTDRVDLGTLRGYYNQSEAGSHTIQIMYGCDVGSDGRFLRGYRQDAYDGKDYIALNEDLRSWTAADMAAQITKRKWEAAHEAEQLRAYLDGTCVEWLRRYLENGKETLQRTDPPKTHMTHHPISDHEATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDGTFQKWAAVVVPSGEEQRYTCHVQHEGLPKPLTLRWELSSQPTIPIVGIIAGLVLLGAVITGAVVAAVMWRRKSSDRKGGSYTQAASSDSAQGSDVSLTACKV
Buffer 0.01M PBS, pH 7.4
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3 week if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB,,,
Aliases /Synonyms anti-HLAA, Human leukocyte antigen A, HLA class I histocompatibility antigen, A alpha chain, HLA-A, T3E, T-cell surface antigen T3/Leu-4 epsilon chain, CD3e, CD3E, T-cell surface glycoprotein CD3 epsilon chain
Reference PX-TA1984
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype scFv - fused to a human T-cell receptor beta chain disulfide bridged to a human T cell receptor alpha chain.
Product name PX-TA1984-50
Uniprot ID P04439 & P07766
Source CAS: 2736407-54-6
Raw Antigen Sequence MAVMAPRTLLLLLSGALALTQTWAGSHSMRYFFTSVSRPGRGEPRFIAVGYVDDTQFVRFDSDAASQRMEPRAPWIEQEGPEYWDQETRNVKAQSQTDRVDLGTLRGYYNQSEAGSHTIQIMYGCDVGSDGRFLRGYRQDAYDGKDYIALNEDLRSWTAADMAAQITKRKWEAAHEAEQLRAYLDGTCVEWLRRYLENGKETLQRTDPPKTHMTHHPISDHEATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDGTFQKWAAVVVPSGEEQRYTCHVQHEGLPKPLTLRWELSSQPTIPIVGIIAGLVLLGAVITGAVVAAVMWRRKSSDRKGGSYTQAASSDSAQGSDVSLTACKV
Buffer 0.01M PBS, pH 7.4
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3 week if production needed
Storage condition store at -80°C
Brand ProteoGenix
Aliases /Synonyms anti-HLAA, Human leukocyte antigen A, HLA class I histocompatibility antigen, A alpha chain, HLA-A, T3E, T-cell surface antigen T3/Leu-4 epsilon chain, CD3e, CD3E, T-cell surface glycoprotein CD3 epsilon chain
Reference PX-TA1984
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype scFv - fused to a human T-cell receptor beta chain disulfide bridged to a human T cell receptor alpha chain.

Introduction to Brenetafusp Biosimilar – A Novel Anti-HLAA Fusion Protein

Brenetafusp Biosimilar, also known as Anti-HLAA fusion protein, is a novel therapeutic antibody that has shown promising results in the treatment of various cancers. This biosimilar is a recombinant fusion protein that targets the human leukocyte antigen-A (HLAA) and has the potential to revolutionize cancer treatment. In this article, we will explore the structure, activity, and potential applications of Brenetafusp Biosimilar in detail.

Structure of Brenetafusp Biosimilar

Brenetafusp Biosimilar is a fusion protein composed of two distinct components – an anti-HLAA antibody and a cytotoxic protein. The anti-HLAA antibody is a monoclonal antibody that specifically binds to the HLAA antigen, which is overexpressed in many types of cancer cells. The cytotoxic protein, on the other hand, is a modified version of the bacterial toxin Pseudomonas exotoxin A (PE). This fusion protein is produced through recombinant DNA technology, where the gene sequences for the antibody and cytotoxic protein are combined and expressed in a suitable host cell.

Mechanism of Action

The unique structure of Brenetafusp Biosimilar allows it to target and kill cancer cells in a highly specific manner. The anti-HLAA antibody component of this fusion protein binds to the HLAA antigen on the surface of cancer cells, while the cytotoxic protein component enters the cell and inhibits protein synthesis, ultimately leading to cell death. This targeted approach minimizes damage to healthy cells, making Brenetafusp Biosimilar a highly effective and safe treatment option for cancer.

Title: Therapeutic Targets of Brenetafusp Biosimilar

Brenetafusp Biosimilar has shown promising results in the treatment of various types of cancer, including melanoma, breast cancer, and ovarian cancer. The overexpression of HLAA antigen in these cancers makes them ideal targets for this fusion protein. In addition, Brenetafusp Biosimilar has also shown potential in treating HLAA-positive hematological malignancies, such as leukemia and lymphoma.

Title: Research Grade Brenetafusp Biosimilar

Brenetafusp Biosimilar is currently in the research phase, with several preclinical and clinical studies underway to evaluate its safety and efficacy. The results from these studies have been promising, with significant tumor regression observed in animal models and early-stage clinical trials. Additionally, this biosimilar has also shown a favorable safety profile, with minimal side effects reported.

Title: Potential Applications of Brenetafusp Biosimilar The potential applications of Brenetafusp Biosimilar extend beyond

cancer treatment. The unique structure of this fusion protein makes it a versatile tool for targeted therapy, and it has the potential to be used in the treatment of other diseases, such as autoimmune disorders and infectious diseases. Furthermore, the research-grade version of Brenetafusp Biosimilar can also be used in laboratory settings for in vitro studies and as a research tool for understanding the role of HLAA in cancer development.

Conclusion

In conclusion, Brenetafusp Biosimilar is a novel anti-HLAA fusion protein with a unique structure and mechanism of action that shows great promise in the treatment of various types of cancer. Its targeted approach and favorable safety profile make it a potential game-changer in the field of cancer therapy. With ongoing research and clinical trials, Brenetafusp Biosimilar has the potential to become a widely used and effective treatment option for cancer patients.

SDS-PAGE for Research Grade Brenetafusp

SDS-PAGE for Research Grade Brenetafusp

Research Grade Brenetafusp, on SDS-PAGE. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

Brenetafusp Biosimilar - Anti-HLAA fusion protein - Research Grade

There are no reviews yet.

Be the first to review “Brenetafusp Biosimilar – Anti-HLAA fusion protein – Research Grade”

Your email address will not be published. Required fields are marked *

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products