Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Acipenser gueldenstaedtii (Russian sturgeon) (Danube sturgeon) Russian sturgeon GTHII/LHB recombinant protein

Host species:
Mammalian cells
Origin species:
Acipenser gueldenstaedtii (Russian sturgeon) (Danube sturgeon)
Uniprot ID:
AAP97490.1
Molecular weight:
41.01 kDa

Original price was: $415.00.Current price is: $330.00.

50ug 20% OFF + 330 loyalty points
Ser20–Tyr137 Fc
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery
Acipenser gueldenstaedtii (Russian sturgeon) (Danube sturgeon) Russian sturgeon GTHII/LHB  recombinant protein

Acipenser gueldenstaedtii (Russian sturgeon) (Danube sturgeon) Russian sturgeon GTHII/LHB recombinant protein

Product name PX-P6460-100
Uniprot ID AAP97490.1
Origin species Acipenser gueldenstaedtii (Russian sturgeon) (Danube sturgeon)
Expression system Eukaryotic expression
Raw Antigen Sequence SSSLRLCEPVNETISAEKEECPKCLLIQTSICSGSCPTKDPVFKSALSTVQQHVCTYKDLRFVTVTLPDCPPGVDPHFTFPLALSCECSLCRMESSDCTIQSVGPSDCMSGELAIQNY
Molecular weight 41.01 kDa
Protein delivered with Tag? C-Terminal Fc Tag
Buffer PBS pH 7.4, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Form Liquid
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Ser20-Tyr137
Aliases /Synonyms GTHIILH beta subunit,
Reference PX-P6460
Molecular Constructor
Ser20–Tyr137 Fc
Product name PX-P6460-1MG
Uniprot ID AAP97490.1
Origin species Acipenser gueldenstaedtii (Russian sturgeon) (Danube sturgeon)
Expression system Eukaryotic expression
Raw Antigen Sequence SSSLRLCEPVNETISAEKEECPKCLLIQTSICSGSCPTKDPVFKSALSTVQQHVCTYKDLRFVTVTLPDCPPGVDPHFTFPLALSCECSLCRMESSDCTIQSVGPSDCMSGELAIQNY
Molecular weight 41.01 kDa
Protein delivered with Tag? C-Terminal Fc Tag
Buffer PBS pH 7.4, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Form Liquid
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Ser20-Tyr137
Aliases /Synonyms GTHIILH beta subunit,
Reference PX-P6460
Molecular Constructor
Ser20–Tyr137 Fc
Product name PX-P6460-50
Uniprot ID AAP97490.1
Origin species Acipenser gueldenstaedtii (Russian sturgeon) (Danube sturgeon)
Expression system Eukaryotic expression
Raw Antigen Sequence SSSLRLCEPVNETISAEKEECPKCLLIQTSICSGSCPTKDPVFKSALSTVQQHVCTYKDLRFVTVTLPDCPPGVDPHFTFPLALSCECSLCRMESSDCTIQSVGPSDCMSGELAIQNY
Molecular weight 41.01 kDa
Protein delivered with Tag? C-Terminal Fc Tag
Buffer PBS pH 7.4, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Form Liquid
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Ser20-Tyr137
Aliases /Synonyms GTHIILH beta subunit,
Reference PX-P6460
Molecular Constructor
Ser20–Tyr137 Fc

Acipenser gueldenstaedtii (Russian sturgeon) (Danube sturgeon) Russian sturgeon GTHII/LHB  recombinant protein

There are no reviews yet.

Be the first to review “Acipenser gueldenstaedtii (Russian sturgeon) (Danube sturgeon) Russian sturgeon GTHII/LHB recombinant protein”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products