Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Human CD85a-LILRB3 recombinant protein

  • PX-P6158
  • Validated ELISA
Host species:
Mammalian cells
Origin species:
Homo sapiens (Human)
Uniprot ID:
O75022
Molecular weight:
49.49 kDa

$380.00

100ug + 380 loyalty points
Met1–Glu443 His
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Human CD85a-LILRB3 recombinant protein

Product name Human CD85a-LILRB3 recombinant protein
Uniprot ID O75022
Origin species Homo sapiens (Human)
Expression system Eukaryotic expression
Raw Antigen Sequence MTPALTALLCLGLSLGPRTRVQAGPFPKPTLWAEPGSVISWGSPVTIWCQGSQEAQEYRLHKEGSPEPLDRNNPLEPKNKARFSIPSMTEHHAGRYRCHYYSSAGWSEPSDPLEMVMTGAYSKPTLSALPSPVVASGGNMTLRCGSQKGYHHFVLMKEGEHQLPRTLDSQQLHSRGFQALFPVGPVTPSHRWRFTCYYYYTNTPWVWSHPSDPLEILPSGVSRKPSLLTLQGPVLAPGQSLTLQCGSDVGYNRFVLYKEGERDFLQRPGQQPQAGLSQANFTLGPVSPSNGGQYRCYGAHNLSSEWSAPSDPLNILMAGQIYDTVSLSAQPGPTVASGENVTLLCQSWWQFDTFLLTKEGAAHPPLRLRSMYGAHKYQAEFPMSPVTSAHAGTYRCYGSYSSNPHLLSHPSEPLELVVSGHSGGSSLPPTGPPSTPGLGRYLE
Molecular weight 49.49 kDa
Protein delivered with Tag? C-Terminal His Tag
Purity estimated >85% by SDS-PAGE
Buffer 0.01M PBS, pH 7.4.
Delivery condition Dry Ice
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Met1-Glu443
Aliases /Synonyms CD85a, ILT-5, Monocyte inhibitory receptor HL9, LILRB3, Immunoglobulin-like transcript 5, CD85 antigen-like family member A, ILT5, Leukocyte immunoglobulin-like receptor 3, LIR-3, Leukocyte immunoglobulin-like receptor subfamily B member 3, LIR3
Reference PX-P6158
Note For research use only
Molecular Constructor
Met1–Glu443 His

Anti-Human CD85a/LILRB3 Antibody (SAA2377) binds to Human CD85a-LILRB3 recombinant protein in ELISA assay

Anti-Human CD85a/LILRB3 Antibody (SAA2377) binds to Human CD85a-LILRB3 recombinant protein in ELISA assay

Immobilized Human CD85a-LILRB3 recombinant protein (cat. No.PX-P6158) at 0.5µg/mL (100µL/well) can bind Anti-Human CD85a/LILRB3 Antibody (SAA2377) (cat. No.ARO-A22786 ) in indirect ELISA with Goat Anti-Human IgG secondary antibody coupled with HRP measured by OD450 giving an EC50 at 114.9M.

Human CD85a-LILRB3 recombinant protein

There are no reviews yet.

Be the first to review “Human CD85a-LILRB3 recombinant protein”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products