Cart (0 Items)
Your cart is currently empty.
View ProductsSize | 100ug, 50ug |
---|---|
Brand | ProteoGenix |
Product type | Recombinant Proteins |
Host Species | Escherichia coli (E. coli) |
Applications | Elisa, WB |
Product name | N-acetylneuraminate lyase(nanA) |
---|---|
Uniprot ID | B1XHJ8 |
Uniprot link | https://www.uniprot.org/uniprot/B1XHJ8 |
Expression system | Prokaryotic expression |
Sequence | MATNLRGVMAALLTPFDQQQALDKASLRRLVQFNIQQGIDGLYVGGSTGEAFVQSLSEREQVLEIVAEEAKGKIKLIAHV GCVSTAESQQLAASAKRYGFDAVSAVTPFYYPFSFEEHCDHYRAIIDSADGLPMVVYNIPALSGVKLTLDQINTLVTLPG VGALKQTSGDLYQMEQIRREHPDLVLYNGYDEIFASGLLAGADGGIGSTYNIMGWRYQGIVKALKEGDIQTAQKLQTECN KVIDLLIKTGVFRGLKTVLHYMDVVSVPLCRKPFGPVDEKYLPELKALAQQLMQERGHHHHHHSAWSHPQFEK |
Molecular weight | 34.56kDa |
Purity estimated | >90% by SDS-PAGE |
Buffer | PBS pH7.5+10%Glycerol |
Delivery condition | Dry Ice |
Delivery lead time in business days | Europe: 5-7 working days USA & Canada: 7-10 working days Rest of the world: 5-12 working days |
Storage condition | 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection) |
Brand | ProteoGenix |
Host species | Escherichia coli (E.coli) |
Fragment Type | Met1-Gly297 |
Aliases /Synonyms | NAL,Neu5Ac lyase,N-acetylneuraminate pyruvate-lyase,N-acetylneuraminic acid aldolase,Sialate lyase,Sialic acid aldolase,Sialic acid lyase |
Reference | PX-P4320 |
Note | For research use only |
Related products
Send us a message from the form below
Reviews
There are no reviews yet.