Cart (0 Items)
Your cart is currently empty.
View Products🚀 Special Offer🚀Get 25% off on your bioreagent online order (except Micelles and Nanodiscs), with the code: PROTEOSHOP25
📢 New ! Accelerate your Antibody Development with Ready-to-use Stable Cell Pools
Explore NowSize | 100ug, 50ug |
---|---|
Brand | ProteoGenix |
Product type | Recombinant Proteins |
Host Species | Escherichia coli (E. coli) |
Applications | Elisa, WB |
Product name | UDP-N-acetylglucosamine 1-carboxyvinyltransferase(murA) |
---|---|
Uniprot ID | P65455 |
Uniprot link | http://www.uniprot.org/uniprot/P65455 |
Expression system | Prokaryotic expression |
Sequence | MLKDVDTSMKLLSQLGAKVERNGSVHIDASQVNVFCAPYDLVKTMRASIWALGPLVARFGQGQVSLPGGCTIGARPVDLH ITGLEQLGATIKLEEGYVKASVEGRLKGAHIVMDKVSVGATVTIMCAATLAEGTTIIENAAREPEIVDTANFLVTLGAKI AGQGTDRITIEGVERLGGGVYRVLPDRIETGTFLVAAAISRGKILCRNAQPDTLDAVLAKLRDAGADIEVGEDWISLDMH GKRPKAVNVRTAPHPAFPTDMQAQFTLLNLVAEGTGFITETVFENRFMHVPELSRMGARAEIESNTVICHGVETLSGAQV MATDLRASASLVLAGCIAEGTTIVDRIYHIDRGYERIEDKLRALGANIERVKGELEHHHHHH |
Molecular weight | 40.98kDa |
Purity estimated | 85% by SDS-PAGE |
Buffer | PBS, pH 7.5, 4M urea |
Delivery condition | Dry Ice |
Delivery lead time in business days | Europe: 5-7 working days USA & Canada: 7-10 working days Rest of the world: 5-12 working days |
Storage condition | 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection) |
Brand | ProteoGenix |
Host species | Escherichia coli (E.coli) |
Fragment Type | Leu47-Glu419 |
Aliases /Synonyms | Enoylpyruvate transferase, UDP-N-acetylglucosamine enolpyruvyl transferase, EPT |
Reference | PX-P4525 |
Note | For research use only |
Related products
Send us a message from the form below
Your cart is currently empty.
View Products
Reviews
There are no reviews yet.