Cart (0 Items)
Your cart is currently empty.
View Productssize | 100ug |
---|---|
Brand | ProteoGenix |
Product type | Recombinant Proteins |
Host Species | Mammalian cells |
Applications | Elisa, WB |
Product name | CD276 Recombinant Protein |
---|---|
Uniprot ID | Q5ZPR3 |
Uniprot link | http://www.uniprot.org/uniprot/Q5ZPR3 |
Origin species | Homo sapiens (Human) |
Expression system | Eukaryotic expression |
Sequence | MLRRRGSPGMGVHVGAALGALWFCLTGALEVQVPEDPVVALVGTDATLCCSFSPEPGFSLAQLNLIWQLTDTKQLVHSFAEGQDQGSAYANRTALFPDLLAQGNASLRLQRVRVADEGSFTCFVSIRDFGSAAVSLQVAAPYSKPSMTLEPNKDLRPGDTVTITCSSYQGYPEAEVFWQDGQGVPLTGNVTTSQMANEQGLFDVHSILRVVLGANGTYSCLVRNPVLQQDAHSSVTITPQRSPTGAVEVQVPEDPVVALVGTDATLRCSFSPEPGFSLAQLNLIWQLTDTKQLVHSFTEGRDQGSAYANRTALFPDLLAQGNASLRLQRVRVADEGSFTCFVSIRDFGSAAVSLQVAAPYSKPSMTLEPNKDLRPGDTVTITCSSYRGYPEAEVFWQDGQGVPLTGNVTTSQMANEQGLFDVHSVLRVVLGANGTYSCLVRNPVLQQDAHGSVTITGQPMT |
Molecular weight | 70kDa |
Protein delivered with Tag? | C-terminal His Tag |
Purity estimated | >95% by SDS-PAGE |
Buffer | PBS pH7.5 |
Delivery condition | Dry Ice |
Storage condition | Store at - 20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. |
Brand | ProteoGenix |
Host species | Mammalian cells |
Fragment Type | Met1-Thr461 |
Aliases /Synonyms | B7H3, PSEC0249, UNQ309/PRO352 |
Reference | PX-P4125 |
Note | For research use only |
CD276, also known as B7-H3, is a member of the B superfamily and has IgV and IgG regions in the extracellular domain. It is a type I transmembrane protein with 20-27% amino acid identity to other members of the B7 family. B7-H3 participates in the activation of T lymphocytes and regulates the formation of mouse bone. It has also been reported that B7-H3 may play an important role in muscle-immune interaction, providing further evidence for the active role of muscle cells in the local immune regulation process. B7-H3 is expressed on T cells, natural lethal cells and antigenic cells, and certain non-immune cells (such as osteoblasts, fibroblasts, fibroblast-like synovial cells, and epithelial cells). The high expression of B7-H3 in the tumor vasculature also indicates poor patient survival, indicating that it may play a role in the migration of tumor cells.
Immobilized CD276 Recombinant Protein (cat. No.PX-P4125) at 0.5µg/mL (100µL/well) can bind to Enoblituzumab Biosimilar - Anti-CD276, B7-H3 mAb (cat. No.PX-TA1410) in indirect ELISA with Goat Anti-Human IgG secondary antibody coupled with HRP measured by OD450
Send us a message from the form below
Reviews
There are no reviews yet.