Cart (0 Items)
Your cart is currently empty.
View Products-
-
-
Drosophila Hh Recombinant Protein
| Size | 100ug, 50ug |
|---|---|
| Brand | ProteoGenix |
| Product type | Recombinant Proteins |
| Host Species | Escherichia coli (E. coli) |
| Applications | Elisa, WB |
| Product name | Drosophila Hh Recombinant Protein |
|---|---|
| Uniprot ID | B4R1D8 |
| Uniprot link | http://www.uniprot.org/uniprot/B4R1D8 |
| Origin species | Drosophila |
| Expression system | Prokaryotic expression |
| Sequence | MAHNHRHKHKLAHSCGPGRGLGRHRARNLYPLVLKQTIPNLSEYTNSASGPLEGVIRRDSPKFKDLVPNYNRDILFRDEE GTGADRLMSKRCKEKLNVLAYSVMNEWPGIRLLVTESWDEDYHHGQESLHYEGRAVTIATSDRDQSKYGMLARLAVEAGF DWVSYVSRRHIYCSVKSDSSISSHVHG |
| Molecular weight | 21,27 kDa |
| Protein delivered with Tag? | Yes |
| Purity estimated | 80% |
| Buffer | PBS, Urea 8M |
| Form | liquid |
| Delivery condition | Dry Ice |
| Delivery lead time in business days | 10-25 |
| Storage condition | 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection) |
| Brand | ProteoGenix |
| Host species | Escherichia coli (E.coli) |
| Fragment Type | Partial |
| Protein Accession | XP_002104521.1 |
| Spec:Entrez GeneID | 6729200 |
| Spec:NCBI Gene Aliases | GD18403, dsim_GLEANR_2228 |
| Spec:SwissProtID | B4R1D8 |
| NCBI Reference | XP_002104521.1 |
| Aliases /Synonyms | Hh, hedgehog |
| Reference | PX-P1110 |
| Note | For research use only |
Related products
Biosimilar
Lilotomab Biosimilar – Anti-CD37 mAb – Research Grade
PX-TA1378 238$
Biosimilar
Rimteravimab Biosimilar – Anti-Spike RBD mAb – Research Grade
PX-TA1804 238$
Biosimilar
Fiztasovimab Biosimilar – Anti-HHV gB AD-1 mAb – Research Grade
PX-TA1841 440$Contact us
Send us a message from the form below
Reviews
There are no reviews yet.