Cart (0 Items)
Your cart is currently empty.
View Products
| size | 100ug, 50ug |
|---|---|
| Brand | ProteoGenix |
| Product type | Recombinant Proteins |
| Host Species | Escherichia coli (E. coli) |
| Applications | Elisa, WB |
| Product name | Human VEGF Recombinant Protein |
|---|---|
| Uniprot ID | P15692 |
| Uniprot link | http://www.uniprot.org/uniprot/P15692 |
| Origin species | Homo sapiens (Human) |
| Expression system | Prokaryotic expression |
| Sequence | MAHNHRHKHKLDDDDKAPMAEGGGQNHHEVVKFMDVYQRSYCHPIETLVDIFQEYPDEIEYIFKPSCVPLMRCGGCCNDEGLECVPTEESNITMQIMRIKPHQGQHIGEMSFLQHNKCECRPKKDR |
| Molecular weight | 14,65 kDa |
| Protein delivered with Tag? | Yes |
| Purity estimated | 70% |
| Buffer | PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol |
| Form | Frozen |
| Delivery condition | Dry Ice |
| Delivery lead time in business days | 3-5 days if in stock; 3-5 weeks if production needed |
| Storage condition | 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection) |
| Brand | ProteoGenix |
| Host species | Escherichia coli (E.coli) |
| Fragment Type | Partial |
| Protein Accession | AAH65522.2 |
| Spec:Entrez GeneID | 7422 |
| Spec:NCBI Gene Aliases | MVCD1, VPF, VEGF |
| Spec:SwissProtID | P15692 |
| NCBI Reference | AAH65522.2 |
| Aliases /Synonyms | VEGF, VEGFA protein, Vascular endothelial Growth Factor proteins A, VEGF-A, Vascular permeability factor, VPF, VEGFA |
| Reference | PX-P1060 |
| Note | For research use only. |
Human VEGF Recombinant Protein, on SDS-PAGE under reducing condition. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.
Related products
Send us a message from the form below
Reviews
There are no reviews yet.