Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human ERAL1 Protein, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
O75616
Molecular weight:
20.54 kDa

Original price was: $396.00.Current price is: $327.00.

100ug 17% OFF + 327 loyalty points
Arg94–Glu256
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human ERAL1 Protein, N-His

Product name ARO-P12375-100
Uniprot ID O75616
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence RDEQDVLLVHHPDMPENSRVLRVVLLGAPNAGKSTLSNQLLGRKVFPVSRKVHTTRCQALGVITEKETQVILLDTPGIISPGKQKRHHLELSLLEDPWKSMESADLVVVLVDVSDKWTRNQLSPQLLRCLTKYSQIPSVLVMNKVDCLKQKSVLLELTAALTE
Molecular weight 20.54 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Arg94-Glu256
Aliases /Synonyms Conserved ERA-like GTPase, HERA, GTPase Era, mitochondrial, ERA-like protein 1, H-ERA, ERAL1, hERA, ERA-W, CEGA
Reference ARO-P12375
Note For research use only.
Molecular Constructor
Arg94–Glu256
Product name ARO-P12375-1MG
Uniprot ID O75616
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence RDEQDVLLVHHPDMPENSRVLRVVLLGAPNAGKSTLSNQLLGRKVFPVSRKVHTTRCQALGVITEKETQVILLDTPGIISPGKQKRHHLELSLLEDPWKSMESADLVVVLVDVSDKWTRNQLSPQLLRCLTKYSQIPSVLVMNKVDCLKQKSVLLELTAALTE
Molecular weight 20.54 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Arg94-Glu256
Aliases /Synonyms Conserved ERA-like GTPase, HERA, GTPase Era, mitochondrial, ERA-like protein 1, H-ERA, ERAL1, hERA, ERA-W, CEGA
Reference ARO-P12375
Note For research use only.
Molecular Constructor
Arg94–Glu256
Product name ARO-P12375-50
Uniprot ID O75616
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence RDEQDVLLVHHPDMPENSRVLRVVLLGAPNAGKSTLSNQLLGRKVFPVSRKVHTTRCQALGVITEKETQVILLDTPGIISPGKQKRHHLELSLLEDPWKSMESADLVVVLVDVSDKWTRNQLSPQLLRCLTKYSQIPSVLVMNKVDCLKQKSVLLELTAALTE
Molecular weight 20.54 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Arg94-Glu256
Aliases /Synonyms Conserved ERA-like GTPase, HERA, GTPase Era, mitochondrial, ERA-like protein 1, H-ERA, ERAL1, hERA, ERA-W, CEGA
Reference ARO-P12375
Note For research use only.
Molecular Constructor
Arg94–Glu256

Introduction

Recombinant Human ERAL1 protein is a highly conserved protein that plays a crucial role in various cellular processes. It is a member of the GTP-binding protein family and is involved in the regulation of RNA metabolism, mitochondrial function, and cellular proliferation. In this article, we will discuss the structure, activity, and applications of this important protein.

Structure of Recombinant Human ERAL1 Protein

Recombinant Human ERAL1 protein is encoded by the ERAL1 gene located on chromosome 1 in humans. It is composed of 339 amino acids and has a molecular weight of approximately 38 kDa. The protein has a conserved GTP-binding domain and a C-terminal RNA-binding domain. It also contains a mitochondrial targeting sequence, which is responsible for its localization in the mitochondria.

Activity of Recombinant Human ERAL1 Protein

Recombinant Human ERAL1 protein is a GTPase that plays a critical role in the regulation of RNA metabolism. It interacts with various proteins involved in RNA processing, including ribonucleases, RNA helicases, and RNA polymerases. This protein is also involved in the assembly and maintenance of the mitochondrial ribosome, which is responsible for the production of proteins essential for mitochondrial function.

The GTP-binding activity of ERAL1 is essential for its function. It binds to GTP and undergoes a conformational change, which allows it to interact with its target proteins. This interaction is crucial for the regulation of RNA metabolism and mitochondrial function.

Applications of Recombinant Human ERAL1 Protein

Recombinant Human ERAL1 protein has various applications in both basic research and clinical settings. Some of the key applications are listed below:

1. Study of RNA metabolism

As ERAL1 is involved in the regulation of RNA metabolism, recombinant Human ERAL1 protein is widely used in studies related to RNA processing, translation, and degradation. Its interaction with various RNA-binding proteins and its role in the assembly of the mitochondrial ribosome make it an essential tool for understanding the complex processes involved in RNA metabolism.

2. Investigation of mitochondrial function

Recombinant Human ERAL1 protein is crucial for the assembly and maintenance of the mitochondrial ribosome. Therefore, it is widely used to study mitochondrial function and its role in cellular processes such as energy production, apoptosis, and cell signaling. Its GTPase activity is also important for the regulation of mitochondrial protein synthesis, making it a valuable tool for investigating mitochondrial dysfunction in various diseases.

3. Development of therapeutics

The involvement of ERAL1 in various cellular processes makes it an attractive target for drug development. Recombinant Human ERAL1 protein is used in drug screening assays to identify compounds that can modulate its activity. These compounds have the potential to treat diseases associated with ERAL1 dysregulation, such as cancer, neurodegenerative disorders, and mitochondrial diseases.

4. Diagnostic marker

Recent studies have shown that ERAL1 is overexpressed in certain types of cancer, making it a potential diagnostic marker. Recombinant Human ERAL1 protein can be used in diagnostic tests to detect its expression levels in patient samples, which can aid in the early detection and treatment of cancer.

Conclusion

In summary, Recombinant Human ERAL1 protein is a crucial player in various cellular processes, including RNA metabolism and mitochondrial function. Its structure, GTPase activity, and involvement in multiple cellular pathways make it an essential tool for both basic research and clinical applications. Further studies on this protein are likely to uncover its full potential and lead to the development of novel therapeutics for various diseases.

Recombinant Human ERAL1 Protein, N-His

There are no reviews yet.

Be the first to review “Recombinant Human ERAL1 Protein, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products