Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Tubulin beta-3 chain(TUBB3)

Host species:
Escherichia coli (E.coli)
Uniprot ID:
Q13509
Molecular weight:
51.7kDa

$250.00

50ug + 250 loyalty points
Met1–Lys450 His
size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Tubulin beta-3 chain(TUBB3)

Product name Tubulin beta-3 chain(TUBB3)
Uniprot ID Q13509
Uniprot link https://www.uniprot.org/uniprot/Q13509
Expression system Prokaryotic expression
Raw Antigen Sequence MREIVHIQAGQCGNQIGAKFWEVISDEHGIDPSGNYVGDSDLQLERISVYYNEASSHKYVPRAILVDLEPGTMDSVRSGAFGHLFRPDNFIFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKECENCDCLQGFQLTHSLGGGTGSGMGTLLISKVREEYPDRIMNTFSVVPSPKVSDTVVEPYNATLSIHQLVENTDETYCIDNEALYDICFRTLKLATPTYGDLNHLVSATMSGVTTSLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTARGSQQYRALTVPELTQQMFDAKNMMAACDPRHGRYLTVATVFRGRMSMKEVDEQMLAIQSKNSSYFVEWIPNNVKVAVCDIPPRGLKMSSTFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATAEEEGEMYEDDEEESEAQGPKAAALEHHHHHH
Molecular weight 51.7kDa
Protein delivered with Tag? C-terminal His Tag
Purity estimated >80% by SDS-PAGE
Buffer PBS, pH7.5
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met1-Lys450
Protein Accession Q13509
Spec:Entrez GeneID 10381
Spec:NCBI Gene Aliases CDCBM; FEOM3; TUBB4; CDCBM1; CFEOM3; beta-4; CFEOM3A
Spec:SwissProtID Q9BTZ0
NCBI Reference Q13509
Aliases /Synonyms Tubulin beta-4 chain,Tubulin beta-III,TUBB4
Reference PX-P4849
Note For research use only
Molecular Constructor
Met1–Lys450 His
Product name Tubulin beta-3 chain(TUBB3)
Uniprot ID Q13509
Uniprot link https://www.uniprot.org/uniprot/Q13509
Expression system Prokaryotic expression
Raw Antigen Sequence MREIVHIQAGQCGNQIGAKFWEVISDEHGIDPSGNYVGDSDLQLERISVYYNEASSHKYVPRAILVDLEPGTMDSVRSGAFGHLFRPDNFIFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKECENCDCLQGFQLTHSLGGGTGSGMGTLLISKVREEYPDRIMNTFSVVPSPKVSDTVVEPYNATLSIHQLVENTDETYCIDNEALYDICFRTLKLATPTYGDLNHLVSATMSGVTTSLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTARGSQQYRALTVPELTQQMFDAKNMMAACDPRHGRYLTVATVFRGRMSMKEVDEQMLAIQSKNSSYFVEWIPNNVKVAVCDIPPRGLKMSSTFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATAEEEGEMYEDDEEESEAQGPKAAALEHHHHHH
Molecular weight 51.7kDa
Protein delivered with Tag? C-terminal His Tag
Purity estimated >80% by SDS-PAGE
Buffer PBS, pH7.5
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met1-Lys450
Protein Accession Q13509
Spec:Entrez GeneID 10381
Spec:NCBI Gene Aliases CDCBM; FEOM3; TUBB4; CDCBM1; CFEOM3; beta-4; CFEOM3A
Spec:SwissProtID Q9BTZ0
NCBI Reference Q13509
Aliases /Synonyms Tubulin beta-4 chain,Tubulin beta-III,TUBB4
Reference PX-P4849
Note For research use only
Molecular Constructor
Met1–Lys450 His

There are no reviews yet.

Be the first to review “Tubulin beta-3 chain(TUBB3)”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products