Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Xeligekimab Biosimilar – Anti-IL17 mAb – Research Grade

  • PX-TA1766-50
  • Validated ELISA FC WB
Clonality:
Monoclonal Antibody
Isotype:
IgG4, Kappa

Original price was: $209.00.Current price is: $167.00.

50ug 20% OFF + 167 loyalty points
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Xeligekimab Biosimilar - Anti-IL17 mAb - Research Grade

Product name Xeligekimab Biosimilar - Anti-IL17 mAb - Research Grade
Uniprot ID Q16552
Source CAS: 2382921-73-3
Species Humanized
Raw Antigen Sequence MTPGKTSLVSLLLLLSLEAIVKAGITIPRNPGCPNSEDKNFPRTVMVNLNIHNRNTNTNPKRSSDYYNRSTSPWNLHRNEDPERYPSVIWEAKCRHLGCINADGNVDYHMNSVPIQQEILVLRREPPHCPNSFRLEKILVSVGCTCVTPIVHHVA
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3 week if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB
Aliases /Synonyms Xeligekimab,GR 1501,GR-1501, GR1501,IL17,anti-IL17
Reference PX-TA1766
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG4-kappa
Clonality Monoclonal Antibody
Product name Xeligekimab Biosimilar - Anti-IL17 mAb - Research Grade
Uniprot ID Q16552
Source CAS: 2382921-73-3
Species Humanized
Expression system XtenCHO
Raw Antigen Sequence MTPGKTSLVSLLLLLSLEAIVKAGITIPRNPGCPNSEDKNFPRTVMVNLNIHNRNTNTNPKRSSDYYNRSTSPWNLHRNEDPERYPSVIWEAKCRHLGCINADGNVDYHMNSVPIQQEILVLRREPPHCPNSFRLEKILVSVGCTCVTPIVHHVA
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3 week if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB,,,
Aliases /Synonyms Xeligekimab,GR 1501,GR-1501, GR1501,IL17,anti-IL17
Reference PX-TA1766
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG4-kappa
Clonality Monoclonal Antibody
Product name PX-TA1766-50
Uniprot ID Q16552
Source CAS: 2382921-73-3
Species Humanized
Raw Antigen Sequence MTPGKTSLVSLLLLLSLEAIVKAGITIPRNPGCPNSEDKNFPRTVMVNLNIHNRNTNTNPKRSSDYYNRSTSPWNLHRNEDPERYPSVIWEAKCRHLGCINADGNVDYHMNSVPIQQEILVLRREPPHCPNSFRLEKILVSVGCTCVTPIVHHVA
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3 week if production needed
Storage condition store at -80°C
Brand ProteoGenix
Aliases /Synonyms Xeligekimab,GR 1501,GR-1501, GR1501,IL17,anti-IL17
Reference PX-TA1766
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG4, Kappa
Clonality Monoclonal Antibody

Introduction

Xeligekimab Biosimilar, also known as Anti-IL17 mAb, is a research grade antibody that targets the cytokine interleukin 17 (IL-17). This antibody has shown promising results in pre-clinical studies and is currently being developed as a potential therapeutic for various inflammatory diseases. In this article, we will discuss the structure, activity, and potential applications of Xeligekimab Biosimilar.

Structure of Xeligekimab Biosimilar

Xeligekimab Biosimilar is a monoclonal antibody (mAb) that specifically binds to IL-17. It is composed of two heavy chains and two light chains, each containing a variable region and a constant region. The variable region is responsible for binding to the target molecule, while the constant region determines the antibody’s effector functions.

The variable region of Xeligekimab Biosimilar is derived from a human antibody, while the constant region is modified to enhance its stability and half-life. This modification is known as antibody engineering and allows for better pharmacokinetics and pharmacodynamics of the antibody.

Activity of Xeligekimab Biosimilar

The primary activity of Xeligekimab Biosimilar is to block the activity of IL-17. IL-17 is a pro-inflammatory cytokine that plays a crucial role in various autoimmune and inflammatory diseases. By binding to IL-17, Xeligekimab Biosimilar prevents it from interacting with its receptor and initiating the inflammatory response.

In addition to its primary activity, Xeligekimab Biosimilar also has effector functions such as antibody-dependent cellular cytotoxicity (ADCC) and complement-dependent cytotoxicity (CDC). These functions allow the antibody to recruit immune cells and trigger the destruction of cells that express IL-17, further reducing the inflammatory response.

Potential Applications of Xeligekimab Biosimilar

Xeligekimab Biosimilar has shown promising results in pre-clinical studies for the treatment of various inflammatory diseases, including psoriasis, rheumatoid arthritis, and inflammatory bowel disease. These diseases are characterized by an overproduction of IL-17 and can be effectively treated by blocking its activity.

Moreover, Xeligekimab Biosimilar has the potential to be used in combination with other therapies, such as TNF inhibitors, to provide a more comprehensive treatment approach for these diseases. This antibody also has the potential to be used in other inflammatory conditions, such as asthma and multiple sclerosis, where IL-17 has been implicated.

Conclusion

In conclusion, Xeligekimab Biosimilar is a research grade antibody that targets IL-17 and has shown promising results in pre-clinical studies for the treatment of various inflammatory diseases. Its unique structure and activity make it a potential therapeutic for conditions where IL-17 plays a significant role. Further studies and clinical trials are needed to fully evaluate the efficacy and safety of Xeligekimab Biosimilar in treating these diseases.

SDS-PAGE for Xeligekimab Biosimilar - Anti-IL17 mAb - Research Grade

SDS-PAGE for Xeligekimab Biosimilar - Anti-IL17 mAb - Research Grade

Xeligekimab Biosimilar - Anti-IL17 mAb - Research Grade, on SDS-PAGE. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

Xeligekimab Biosimilar - Anti-IL17 mAb - Research Grade in ELISA Assay

Xeligekimab Biosimilar - Anti-IL17 mAb - Research Grade in ELISA Assay

Xeligekimab Biosimilar - Anti-IL17 mAb - Research Grade can bind to its target in indirect ELISA with Goat secondary antibody measured by OD450.

Xeligekimab Biosimilar - Anti-IL17 mAb - Research Grade

There are no reviews yet.

Be the first to review “Xeligekimab Biosimilar – Anti-IL17 mAb – Research Grade”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products