Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Anti-Human LSP1 VHH (SAA1249)

Note:
For research use only. Not suitable for human use.

$452.00

100ug + 452 loyalty points
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Anti-Human LSP1 VHH (SAA1249)

Product name Anti-Human LSP1 VHH (SAA1249)
Uniprot ID P33241
Raw Antigen Sequence MAEASSDPGAEEREELLGPTAQWSVEDEEEAVHEQCQHERDRQLQAQDEEGGGHVPERPKQEMLLSLKPSEAPELDEDEGFGDWSQRPEQRQQHEGAQGALDSGEPPQCRSPEGEQEDRPGLHAYEKEDSDEVHLEELSLSKEGPGPEDTVQDNLGAAGAEEEQEEHQKCQQPRTPSPLVLEGTIEQSSPPLSPTTKLIDRTESLNRSIEKSNSVKKSQPDLPISKIDQWLEQYTQAIETAGRTPKLARQASIELPSMAVASTKSRWETGEVQAQSAAKTPSCKDIVAGDMSKKSLWEQKGGSKTSSTIKSTPSGKRYKFVATGHGKYEKVLVEGGPAP
Form 0.01M PBS, pH 7.4.
Delivery condition Blue ice (+4°C)
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species XtenCHO
Reactivity Human
Aliases /Synonyms anti-52 kDa phosphoprotein, anti-47 kDa actin-binding protein, anti-pp52, anti-Lymphocyte-specific antigen WP34, anti-Lymphocyte-specific protein 1, anti-LSP1, anti-WP34
Reference ARO-A16388
Note For research use only. Not suitable for human use.
Isotype VHH-8His-Cys-tag
Clonality Monoclonal Antibody
Immunogen LSP1
Clone Name SAA1249
Target species Anti-Human Monoclonal Antibody

For research use only. Not suitable for human use.
*NANOBODY® compound or NANOBODIES® compounds are registered trademarks of Ablynx N.V.

SDS-PAGE for Anti-Human LSP1 VHH (SAA1249)

SDS-PAGE for Anti-Human LSP1 VHH (SAA1249)

Anti-Human LSP1 VHH (SAA1249), on SDS-PAGE. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

Anti-Human LSP1 VHH (SAA1249)

There are no reviews yet.

Be the first to review “Anti-Human LSP1 VHH (SAA1249)”

Your email address will not be published. Required fields are marked *

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products