Cart (0 Items)
Your cart is currently empty.
View Products🚀 Special Offer🚀Get 25% off on your bioreagent online order (except Micelles and Nanodiscs), with the code: PROTEOSHOP25
📢 New ! Accelerate your Antibody Development with Ready-to-use Stable Cell Pools
Explore Now
| size | 100ug |
|---|---|
| Brand | ProteoGenix |
| Product type | Recombinant Proteins |
| Host Species | Mammalian cells |
| Applications | Elisa, WB |
| Product name | CD152 Recombinant Protein |
|---|---|
| Uniprot ID | P16410 |
| Uniprot link | http://www.uniprot.org/uniprot/P16410 |
| Origin species | Homo sapiens (Human) |
| Expression system | Eukaryotic expression |
| Sequence | MACLGFQRHKAQLNLATRTWPCTLLFFLLFIPVFCKAMHVAQPAVVLASSRGIASFVCEYASPGKATEVRVTVLRQADSQVTEVCAATYMMGNELTFLDDSICTGTSSGNQVNLTIQGLRAMDTGLYICKVELMYPPPYYLGIGNGTQIYVIDPEPCPDSD |
| Molecular weight | 18.51kDa |
| Protein delivered with Tag? | C-terminal His Tag |
| Purity estimated | >90% by SDS-PAGE |
| Buffer | PBS pH7.5 |
| Delivery condition | Dry Ice |
| Storage condition | Store at - 20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. |
| Brand | ProteoGenix |
| Host species | Mammalian cells |
| Fragment Type | Met1~Asp161 |
| Aliases /Synonyms | CD152 |
| Reference | PX-P4108 |
| Note | For research use only |
CD152, also known as CTLA4 and cytotoxic T lymphocyte protein 4, is a single-pass type I membrane protein and a member of the immunoglobulin superfamily. It is the second member of the CD28 receptor. The ligands or counterreceptors of these two proteins belong to the B7, CD8 (B7-1) and CD86 (B7-2) families. CTLA4 delivers inhibitory signals to T lymphocytes, while CD28 delivers stimulatory signals. Intracellular CTLA4 is also present in regulatory T cells and may play an important role in its function. CD152 antigen or cytotoxic T lymphocytes (CTLA-4) are important receptors involved in downregulating T-cell activation. Due to its far-reaching inhibitory effect, CD152 is considered a candidate solid acceptable for autoimmunity and a convincing target for cancer immunotherapy. In particular, recent evidence suggests that CD152 is also important in homeostasis and the function of population suppressor cells called regulatory T cells (Treg).
Immobilized CD152 Recombinant Protein (cat. No.PX-P4108) at 0.5µg/mL (100µL/well) can bind to Tremelimumab Biosimilar - Anti-CTLA4, CD152 mAb (cat. No.PX-TA1177) in indirect ELISA with Goat Anti-Human IgG secondary antibody coupled with HRP measured by OD450
Related products
Send us a message from the form below
Your cart is currently empty.
View Products
Reviews
There are no reviews yet.