Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Nurulimab Biosimilar – Anti-CTLA4 mAb – Research Grade

  • PX-TA1597-50
  • Validated ELISA
Clonality:
Monoclonal Antibody
Isotype:
IgG1, kappa

Original price was: $225.00.Current price is: $167.00.

50ug 26% OFF + 167 loyalty points
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Nurulimab Biosimilar - Anti-CTLA4 mAb - Research Grade

Product name Nurulimab Biosimilar - Anti-CTLA4 mAb - Research Grade
Uniprot ID P16410
Species Homo sapiens
Raw Antigen Sequence MACLGFQRHKAQLNLATRTWPCTLLFFLLFIPVFCKAMHVAQPAVVLASSRGIASFVCEYASPGKATEVRVTVLRQADSQVTEVCAATYMMGNELTFLDDSICTGTSSGNQVNLTIQGLRAMDTGLYICKVELMYPPPYYLGIGNGTQIYVIDPEPCPDSDFLLWILAAVSSGLFFYSFLLTAVSLSKMLKKRSPLTTGVYVKMPPTEPECEKQFQPYFIPIN
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB
Aliases /Synonyms Nurulimab ,BCD-145,CTLA4,anti-CTLA4
Reference PX-TA1597
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1-kappa
Clonality Monoclonal Antibody
Product name Nurulimab Biosimilar - Anti-CTLA4 mAb - Research Grade
Uniprot ID P16410
Species Homo sapiens
Raw Antigen Sequence MACLGFQRHKAQLNLATRTWPCTLLFFLLFIPVFCKAMHVAQPAVVLASSRGIASFVCEYASPGKATEVRVTVLRQADSQVTEVCAATYMMGNELTFLDDSICTGTSSGNQVNLTIQGLRAMDTGLYICKVELMYPPPYYLGIGNGTQIYVIDPEPCPDSDFLLWILAAVSSGLFFYSFLLTAVSLSKMLKKRSPLTTGVYVKMPPTEPECEKQFQPYFIPIN
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB,,,
Aliases /Synonyms Nurulimab ,BCD-145,CTLA4,anti-CTLA4
Reference PX-TA1597
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1-kappa
Clonality Monoclonal Antibody
Product name PX-TA1597-50
Uniprot ID P16410
Species Homo sapiens
Raw Antigen Sequence MACLGFQRHKAQLNLATRTWPCTLLFFLLFIPVFCKAMHVAQPAVVLASSRGIASFVCEYASPGKATEVRVTVLRQADSQVTEVCAATYMMGNELTFLDDSICTGTSSGNQVNLTIQGLRAMDTGLYICKVELMYPPPYYLGIGNGTQIYVIDPEPCPDSDFLLWILAAVSSGLFFYSFLLTAVSLSKMLKKRSPLTTGVYVKMPPTEPECEKQFQPYFIPIN
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Aliases /Synonyms Nurulimab ,BCD-145,CTLA4,anti-CTLA4
Reference PX-TA1597
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1, kappa
Clonality Monoclonal Antibody

Nurulimab Biosimilar: A Promising Anti-CTLA4 mAb for Therapeutic Targeting

Nurulimab Biosimilar, also known as anti-CTLA4 monoclonal antibody (mAb), is a novel therapeutic agent that has shown great promise in the treatment of various diseases. This biosimilar is a replica of the original Nurulimab, which is a humanized IgG1 mAb targeting the cytotoxic T-lymphocyte-associated protein 4 (CTLA4). In this article, we will explore the structure, activity, and potential applications of Nurulimab Biosimilar as a therapeutic antibody.

Structure of Nurulimab Biosimilar

Nurulimab Biosimilar is a recombinant protein produced through genetic engineering techniques. It is composed of two identical heavy chains and two identical light chains, each with a molecular weight of approximately 150 kDa. The heavy and light chains are connected by disulfide bonds, forming a Y-shaped structure. The variable regions of the heavy and light chains are responsible for binding to the target antigen, CTLA4.

The amino acid sequence of Nurulimab Biosimilar is highly similar to that of the original Nurulimab, making it a highly specific and potent therapeutic agent. Its structure is designed to mimic the natural human IgG1 antibody, allowing it to interact with the immune system without causing any adverse effects.

Activity of Nurulimab Biosimilar

Nurulimab Biosimilar binds to CTLA4, a protein found on the surface of T-cells, and acts as an immune checkpoint inhibitor. CTLA4 is a negative regulator of T-cell activation and plays a crucial role in maintaining immune homeostasis. By blocking CTLA4, Nurulimab Biosimilar enhances the activation of T-cells, leading to an increased immune response against cancer cells and other diseases.

Studies have shown that Nurulimab Biosimilar has a high binding affinity for CTLA4, with an equilibrium dissociation constant (Kd) in the nanomolar range. This strong binding allows for efficient inhibition of CTLA4 and subsequent T-cell activation.

Applications of Nurulimab Biosimilar

As an anti-CTLA4 mAb, Nurulimab Biosimilar has shown promising results in the treatment of various diseases, especially cancer. It has been extensively studied in clinical trials for the treatment of melanoma, non-small cell lung cancer, and renal cell carcinoma. In these trials, Nurulimab Biosimilar has demonstrated significant antitumor activity, leading to its approval for use in these cancers.

In addition to cancer, Nurulimab Biosimilar has also shown potential in the treatment of autoimmune diseases, such as rheumatoid arthritis and multiple sclerosis. By inhibiting CTLA4, this biosimilar can modulate the immune response and reduce inflammation, providing relief to patients with these conditions.

Furthermore, Nurulimab Biosimilar has also been investigated as a potential therapy for organ transplant rejection. By preventing the inactivation of T-cells, it can help prevent the rejection of transplanted organs and improve patient outcomes.

Conclusion

Nurulimab Biosimilar is a highly promising therapeutic agent that has shown great potential in the treatment of various diseases. Its specific structure and strong binding to CTLA4 make it a potent anti-CTLA4 mAb with minimal side effects. With its approval for use in cancer and ongoing research in other diseases, Nurulimab Biosimilar is set to revolutionize the field of immunotherapy and provide new treatment options for patients in need.

Keywords: Nurulimab Biosimilar, anti-CTLA4 mAb, therapeutic target, antibody, immunotherapy, cancer, autoimmune diseases, organ transplant rejection.

Nurulimab Biosimilar - Anti-CTLA4 mAb - Research Grade in ELISA Assay

Nurulimab Biosimilar - Anti-CTLA4 mAb - Research Grade in ELISA Assay

Nurulimab Biosimilar - Anti-CTLA4 mAb - Research Grade can bind to its target in indirect ELISA with Goat secondary antibody measured by OD450.

SDS-PAGE for Nurulimab Biosimilar - Anti-CTLA4 mAb - Research Grade

SDS-PAGE for Nurulimab Biosimilar - Anti-CTLA4 mAb - Research Grade

Nurulimab Biosimilar - Anti-CTLA4 mAb - Research Grade, on SDS-PAGE. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

Nurulimab  Biosimilar - Anti-CTLA4 mAb - Research Grade

There are no reviews yet.

Be the first to review “Nurulimab Biosimilar – Anti-CTLA4 mAb – Research Grade”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products