Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Zalifrelimab Biosimilar – Anti-CTLA4, CD152 mAb – Research Grade

  • PX-TA1559-50
  • Validated ELISA
Clonality:
Monoclonal Antibody
Isotype:
IgG1, kappa

Original price was: $209.00.Current price is: $167.00.

50ug 20% OFF + 167 loyalty points
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Zalifrelimab Biosimilar - Anti-CTLA4, CD152 mAb - Research Grade

Product name Zalifrelimab Biosimilar - Anti-CTLA4, CD152 mAb - Research Grade
Uniprot ID P16410
Source CAS 2148321-69-9
Species Homo sapiens
Raw Antigen Sequence MACLGFQRHKAQLNLATRTWPCTLLFFLLFIPVFCKAMHVAQPAVVLASSRGIASFVCEYASPGKATEVRVTVLRQADSQVTEVCAATYMMGNELTFLDDSICTGTSSGNQVNLTIQGLRAMDTGLYICKVELMYPPPYYLGIGNGTQIYVIDPEPCPDSDFLLWILAAVSSGLFFYSFLLTAVSLSKMLKKRSPLTTGVYVKMPPTEPECEKQFQPYFIPIN
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB
Aliases /Synonyms Zalifrelimab ,AGEN1884,CTLA4, CD152,anti-CTLA4, CD152
Reference PX-TA1559
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1-kappa
Clonality Monoclonal Antibody
Product name Zalifrelimab Biosimilar - Anti-CTLA4, CD152 mAb - Research Grade
Uniprot ID P16410
Source CAS 2148321-69-9
Species Homo sapiens
Expression system Mammalian cells
Raw Antigen Sequence MACLGFQRHKAQLNLATRTWPCTLLFFLLFIPVFCKAMHVAQPAVVLASSRGIASFVCEYASPGKATEVRVTVLRQADSQVTEVCAATYMMGNELTFLDDSICTGTSSGNQVNLTIQGLRAMDTGLYICKVELMYPPPYYLGIGNGTQIYVIDPEPCPDSDFLLWILAAVSSGLFFYSFLLTAVSLSKMLKKRSPLTTGVYVKMPPTEPECEKQFQPYFIPIN
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB,,,
Aliases /Synonyms Zalifrelimab ,AGEN1884,CTLA4, CD152,anti-CTLA4, CD152
Reference PX-TA1559
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1-kappa
Clonality Monoclonal Antibody
Product name PX-TA1559-50
Uniprot ID P16410
Source CAS 2148321-69-9
Species Homo sapiens
Raw Antigen Sequence MACLGFQRHKAQLNLATRTWPCTLLFFLLFIPVFCKAMHVAQPAVVLASSRGIASFVCEYASPGKATEVRVTVLRQADSQVTEVCAATYMMGNELTFLDDSICTGTSSGNQVNLTIQGLRAMDTGLYICKVELMYPPPYYLGIGNGTQIYVIDPEPCPDSDFLLWILAAVSSGLFFYSFLLTAVSLSKMLKKRSPLTTGVYVKMPPTEPECEKQFQPYFIPIN
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Aliases /Synonyms Zalifrelimab ,AGEN1884,CTLA4, CD152,anti-CTLA4, CD152
Reference PX-TA1559
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1, kappa
Clonality Monoclonal Antibody

Introduction to Zalifrelimab Biosimilar – A Revolutionary Anti-CTLA4 Antibody Introduction:

Zalifrelimab Biosimilar, also known as Anti-CTLA4 or CD152 monoclonal antibody, is a novel therapeutic agent that has shown great potential in the treatment of various cancers. This biosimilar is designed to target and inhibit the activity of the CTLA4 protein, which plays a crucial role in suppressing the immune response. In this article, we will explore the structure, activity, and potential applications of Zalifrelimab Biosimilar in the field of cancer research.

Structure of Zalifrelimab Biosimilar:

Zalifrelimab Biosimilar is a monoclonal antibody that is produced by recombinant DNA technology. It is a humanized IgG1 antibody, meaning that it is derived from human antibodies but has been modified to reduce the risk of immune reactions. The antibody consists of two heavy chains and two light chains, and each chain is composed of variable and constant regions. The variable regions are responsible for binding to the target protein, while the constant regions determine the antibody’s effector functions.

Activity of Zalifrelimab Biosimilar:

The primary function of Zalifrelimab Biosimilar is to block the activity of CTLA4, a protein found on the surface of T cells. CTLA4 is known to act as a “brake” on the immune system, preventing T cells from attacking healthy cells in the body. However, in the case of cancer, this protein can also inhibit the immune response against cancer cells, allowing them to grow and spread. Zalifrelimab Biosimilar binds to CTLA4 and prevents it from interacting with its natural ligands, thus releasing the brake on the immune system and allowing it to attack cancer cells.

Applications of Zalifrelimab Biosimilar:

Zalifrelimab Biosimilar has shown promising results in preclinical and clinical studies for the treatment of various cancers, including melanoma, lung cancer, and bladder cancer. It has been shown to enhance the anti-tumor immune response and improve overall survival in patients. This biosimilar is also being investigated in combination with other cancer therapies, such as immune checkpoint inhibitors and chemotherapy, to further enhance its effectiveness.

In addition to its potential as a cancer treatment, Zalifrelimab Biosimilar also has applications in autoimmune diseases. It has been shown to be effective in treating diseases such as rheumatoid arthritis and type 1 diabetes, where the immune system attacks the body’s own tissues. By blocking CTLA4, this biosimilar can help restore the balance of the immune system and alleviate symptoms in these conditions.

Future Directions:

The development of Zalifrelimab Biosimilar has opened up new possibilities in cancer treatment and immunotherapy. Ongoing research is focused on optimizing the dosing and administration of this biosimilar to improve its efficacy and minimize side effects. Additionally, efforts are being made to identify biomarkers that can predict which patients will respond best to this therapy.

Conclusion:

In conclusion, Zalifrelimab Biosimilar is a promising antibody therapy that targets the CTLA4 protein and has shown great potential in the treatment of cancer and autoimmune diseases. Its unique mechanism of action and favorable safety profile make it a promising addition to the current arsenal of cancer treatments. Further research and clinical trials will help unlock the full potential of this biosimilar and bring hope to patients battling these diseases.

Zalifrelimab Biosimilar - Anti-CD152;CTLA4 mAb - Research Grade binds to CD152 Recombinant Protein in ELISA assay

Zalifrelimab Biosimilar - Anti-CD152;CTLA4 mAb - Research Grade binds to CD152 Recombinant Protein in ELISA assay

Immobilized CD152 Recombinant Protein (cat. No.PX-P4108) at 0.5µg/mL (100µL/well) can bind Zalifrelimab Biosimilar - Anti-CD152;CTLA4 mAb - Research Grade (cat. No.PX-TA1559) in indirect ELISA with Goat Anti-Human IgG secondary antibody coupled with HRP measured by OD450 giving an EC50 at 58.31M.

Zalifrelimab  Biosimilar - Anti-CTLA4, CD152 mAb - Research Grade

There are no reviews yet.

Be the first to review “Zalifrelimab Biosimilar – Anti-CTLA4, CD152 mAb – Research Grade”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products