Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Zalifrelimab ELISA Kit

$1,403.00

96T + 1403 loyalty points
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery
Zalifrelimab ELISA Kit

Zalifrelimab ELISA Kit

Product name Zalifrelimab ELISA Kit
Uniprot ID P16410
Raw Antigen Sequence MACLGFQRHKAQLNLATRTWPCTLLFFLLFIPVFCKAMHVAQPAVVLASSRGIASFVCEYASPGKATEVRVTVLRQADSQVTEVCAATYMMGNELTFLDDSICTGTSSGNQVNLTIQGLRAMDTGLYICKVELMYPPPYYLGIGNGTQIYVIDPEPCPDSDFLLWILAAVSSGLFFYSFLLTAVSLSKMLKKRSPLTTGVYVKMPPTEPECEKQFQPYFIPIN
Delivery condition Blue ice (+4°)
Storage condition The stability of ELISA kit is determined by the loss rate of activity. The loss rate of this kit is less than 10% prior to the expiration date under appropriate storage condition.
Brand ProteoGenix
Size 96T
Reference KPTX197
Note For research use only.
Sample type Plasma, Serum
Target Zalifrelimab
Immunogen Zalifrelimab

Introduction

Zalifrelimab is a novel antibody that has been identified as a potential therapeutic target for various diseases, including cancer. It is a human monoclonal antibody that specifically targets the programmed cell death protein 1 (PD-1) receptor, which is known to play a critical role in regulating the immune response. In this article, we will provide a scientific description of the Zalifrelimab ELISA Kit, which is a valuable tool for studying the structure, activity, and application of this important antibody.

Structure of Zalifrelimab

The Zalifrelimab antibody is a fully human IgG4 monoclonal antibody, meaning it is made entirely of human proteins and has four IgG4 subunits. It is composed of two heavy chains and two light chains, each with a unique amino acid sequence. The heavy chains are approximately 450 amino acids long, while the light chains are approximately 220 amino acids long. The unique structure of Zalifrelimab allows it to bind specifically to the PD-1 receptor with high affinity, making it an effective therapeutic agent.

Activity of Zalifrelimab

The primary activity of Zalifrelimab is its ability to block the interaction between PD-1 and its ligands, PD-L1 and PD-L2. This interaction is known to inhibit the activity of T cells, which are important immune cells involved in fighting against cancer and other diseases. By blocking this interaction, Zalifrelimab allows T cells to become activated and attack cancer cells, leading to their destruction. This mechanism of action has been shown to be effective in various preclinical and clinical studies, making Zalifrelimab a promising therapeutic agent for cancer treatment.

Application of Zalifrelimab ELISA Kit

The Zalifrelimab ELISA Kit is a valuable tool for studying the structure and activity of this important antibody. ELISA stands for Enzyme-Linked Immunosorbent Assay, which is a commonly used laboratory technique for detecting and quantifying specific proteins in a sample. The Zalifrelimab ELISA Kit specifically measures the levels of Zalifrelimab in a given sample, allowing researchers to accurately determine the concentration of this antibody in various biological samples, such as serum or tissue lysates.

The Zalifrelimab ELISA Kit is also useful for studying the binding affinity of Zalifrelimab to the PD-1 receptor. This can be done by performing a competitive ELISA, where a known amount of Zalifrelimab is added to the sample along with a fixed amount of the PD-1 receptor. The level of Zalifrelimab binding to the PD-1 receptor can then be measured, providing valuable information about the strength of this interaction.

Furthermore, the Zalifrelimab ELISA Kit can be used to monitor the levels of Zalifrelimab in patients receiving treatment with this antibody. This can help determine the optimal dosage and frequency of Zalifrelimab administration, as well as assess the effectiveness of the treatment in different patient populations.

Conclusion

In conclusion, Zalifrelimab is a promising therapeutic target for diseases such as cancer, and the Zalifrelimab ELISA Kit is a valuable tool for studying the structure, activity, and application of this important antibody. With its ability to accurately measure Zalifrelimab levels and binding affinity, the ELISA Kit can aid in the development and optimization of Zalifrelimab as a therapeutic agent, ultimately improving patient outcomes.

Zalifrelimab ELISA Kit

There are no reviews yet.

Be the first to review “Zalifrelimab ELISA Kit”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products