Cart (0 Items)
Your cart is currently empty.
View Products
| size | 100ug |
|---|---|
| Brand | ProteoGenix |
| Product type | Recombinant Proteins |
| Host Species | Mammalian cells |
| Applications | Elisa, WB |
| Product name | CD279 Recombinant Protein |
|---|---|
| Uniprot ID | Q15116 |
| Uniprot link | http://www.uniprot.org/uniprot/Q15116 |
| Origin species | Homo sapiens (Human) |
| Expression system | Eukaryotic expression |
| Sequence | MQIPQAPWPVVWAVLQLGWRPGWFLDSPDRPWNPPTFSPALLVVTEGDNATFTCSFSNTSESFVLNWYRMSPSNQTDKLAAFPEDRSQPGQDCRFRVTQLPNGRDFHMSVVRARRNDSGTYLCGAISLAPKAQIKESLRAELRVTERRAEVPTAHPSPSPRPAGQFQTLV |
| Molecular weight | 40kDa |
| Protein delivered with Tag? | C-terminal His Tag |
| Purity estimated | >90% by SDS-PAGE |
| Buffer | PBS pH7.5 |
| Delivery condition | Dry Ice |
| Delivery lead time in business days | 3-5 days if in stock; 3-5 weeks if production needed |
| Storage condition | Store at - 20℃ to -80℃.It is recommended that the protein be aliquoted for optimal storage. |
| Brand | ProteoGenix |
| Host species | Mammalian cells |
| Fragment Type | Met1~Val170 |
| Aliases /Synonyms | PD1 |
| Reference | PX-P4117 |
| Note | For research use only. |
CD279 (programmed cell death protein 1; PD-1) is a type I transmembrane protein that belongs to the CD28 / CTLA-4 family of immune receptors, which mediates signals that regulate immune responses. Members of the CD28 / CTLA-4 family have been shown to promote T cell activation (CD28 and ICOS) or deactivate T cell activation (CTLA-4 and PD-1). CD279 is expressed on activated T cells, B cells, bone marrow cells, and some thymocytes. In vitro, CD279 binding can prevent TCR-mediated T cell proliferation and the production of IL-1, IL-4, IL-10, and IFN-γ. Furthermore, the binding of CD279 can also prevent BCR signaling. CD279-deficient mice have defective peripheral tolerance and spontaneously develop autoimmune diseases.
Immobilized CD279 Recombinant Protein (cat. No.PX-P4117) at 0.5µg/mL (100µL/well) can bind to Nivolumab Biosimilar - Anti-PD1 mAb (cat. No.PX-TA1004) in indirect ELISA with Goat Anti-Human IgG secondary antibody coupled with HRP measured by OD450
Immobilized CD279 Recombinant Protein (cat. No.PX-P4117) at 0.5µg/mL (100µL/well) can bind to Dostarlimab Biosimilar - Anti-PDCD1, PD1, CD279 mAb (cat. No.PX-TA1526) in indirect ELISA with Goat Anti-Human IgG secondary antibody coupled with HRP measured by OD450
Immobilized CD279 Recombinant Protein (cat. No.PX-P4117) at 0.5µg/mL (100µL/well) can bind Cemiplimab Biosimilar - Anti-PDCD1, PD1, CD279 mAb - Research Grade (cat. No.PX-TA1524) in indirect ELISA with Goat Anti-Human IgG secondary antibody coupled with HRP measured by OD450 giving an EC50 at 905.4M.
Immobilized CD279 Recombinant Protein (cat. No.PX-P4117) at 0.5µg/mL (100µL/well) can bind Balstilimab Biosimilar - Anti-PDCD1; PD1; CD279 mAb - Research Grade (cat. No.PX-TA1558) in indirect ELISA with Goat Anti-Human IgG secondary antibody coupled with HRP measured by OD450 giving an EC50 at 9.940M.
Immobilized CD279 Recombinant Protein (cat. No.PX-P4117) at 0.5µg/mL (100µL/well) can bind Cetrelimab Biosimilar - Anti-PDCD1; PD1; CD279 mAb - Research Grade (cat. No.PX-TA1513) in indirect ELISA with Goat Anti-Human IgG secondary antibody coupled with HRP measured by OD450 giving an EC50 at 99.31M.
Immobilized CD279 Recombinant Protein (cat. No.PX-P4117) at 0.5µg/mL (100µL/well) can bind Tislelizumab Biosimilar - Anti-PDCD1; PD1; CD279 mAb - Research Grade (cat. No.PX-TA1479) in indirect ELISA with Goat Anti-Human IgG secondary antibody coupled with HRP measured by OD450 giving an EC50 at 133.8M.
Immobilized CD279 Recombinant Protein (cat. No.PX-P4117) at 0.5µg/mL (100µL/well) can bind Sintilimab Biosimilar - Anti-PDCD1; PD1; CD279 mAb - Research Grade (cat. No.PX-TA1536) in indirect ELISA with Goat Anti-Human IgG secondary antibody coupled with HRP measured by OD450 giving an EC50 at 44.44M.
Immobilized CD279 Recombinant Protein (cat. No.PX-P4117) at 0.5µg/mL (100µL/well) can bind Toripalimab Biosimilar - Anti-PDCD1; PD1; CD279 mAb - Research Grade (cat. No.PX-TA1540) in indirect ELISA with Goat Anti-Human IgG secondary antibody coupled with HRP measured by OD450 giving an EC50 at 46.26M.
Immobilized CD279 Recombinant Protein (cat. No.PX-P4117) at 0.5µg/mL (100µL/well) can bind to Pembrolizumab Biosimilar - Anti-PD1 mAb (cat. No.PX-TA1007) in indirect ELISA with Goat Anti-Human IgG secondary antibody coupled with HRP measured by OD450
Related products
Send us a message from the form below
Reviews
There are no reviews yet.