Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

CD53 Recombinant Protein

Host species:
Mammalian cells
Origin species:
Homo sapiens (Human)
Uniprot ID:
P19397
Molecular weight:
50-75kDa

Original price was: $409.00.Current price is: $350.00.

50ug 14% OFF + 350 loyalty points
Glu107–Asn181 His
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

CD53 Recombinant Protein

Product name PX-P4127-100
Uniprot ID P19397
Uniprot link http://www.uniprot.org/uniprot/P19397
Origin species Homo sapiens (Human)
Expression system Eukaryotic expression
Raw Antigen Sequence EQKLNEYVAKGLTDSIHRYHSDNSTKAAWDSIQSFLQCCGINGTSDWTSGPPASCPSDRKVEGCYAKARLWFHSN
Molecular weight 50-75kDa
Protein delivered with Tag? C-terminal His Tag
Purity estimated >95% by SDS-PAGE
Buffer PBS pH7.5
Delivery condition Dry Ice
Storage condition Store at - 20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage.
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Glu107-Asn181
Aliases /Synonyms MOX44, TSPAN25
Reference PX-P4127
Note For research use only
Molecular Constructor
Glu107–Asn181 His
Product name PX-P4127-1MG
Uniprot ID P19397
Uniprot link http://www.uniprot.org/uniprot/P19397
Origin species Homo sapiens (Human)
Expression system Eukaryotic expression
Raw Antigen Sequence EQKLNEYVAKGLTDSIHRYHSDNSTKAAWDSIQSFLQCCGINGTSDWTSGPPASCPSDRKVEGCYAKARLWFHSN
Molecular weight 50-75kDa
Protein delivered with Tag? C-terminal His Tag
Purity estimated >95% by SDS-PAGE
Buffer PBS pH7.5
Delivery condition Dry Ice
Storage condition Store at - 20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage.
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Glu107-Asn181
Aliases /Synonyms MOX44, TSPAN25
Reference PX-P4127
Note For research use only
Molecular Constructor
Glu107–Asn181 His
Product name PX-P4127-50
Uniprot ID P19397
Uniprot link http://www.uniprot.org/uniprot/P19397
Origin species Homo sapiens (Human)
Expression system Eukaryotic expression
Raw Antigen Sequence EQKLNEYVAKGLTDSIHRYHSDNSTKAAWDSIQSFLQCCGINGTSDWTSGPPASCPSDRKVEGCYAKARLWFHSN
Molecular weight 50-75kDa
Protein delivered with Tag? C-terminal His Tag
Purity estimated >95% by SDS-PAGE
Buffer PBS pH7.5
Delivery condition Dry Ice
Storage condition Store at - 20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage.
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Glu107-Asn181
Aliases /Synonyms MOX44, TSPAN25
Reference PX-P4127
Note For research use only
Molecular Constructor
Glu107–Asn181 His

General information on CD53 Recombinant Protein:

CD53 is a member of the transmembrane superfamily 4, also known as the tetraspanin family. Most of these members are cell surface proteins, which are characterized by the presence of four hydrophobic domains. These proteins measure signal transduction events that play a role in regulating cell development, activation, growth and movement. CD53 is a cell surface glycoprotein known to be complex with integrins. Common defects in the CD53 gene are linked to immunodeficiency, which is related to recurrent infectious diseases caused by bacteria, fungi and viruses. CD53 contributes to the transduction of signals produced by CD2 in T cells and natural lethal cells and is thought to play a role in regulating growth.

CD53 Recombinant Protein

There are no reviews yet.

Be the first to review “CD53 Recombinant Protein”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products