Cart (0 Items)
Your cart is currently empty.
View Productssize | 100ug |
---|---|
Brand | ProteoGenix |
Product type | Recombinant Proteins |
Host Species | Mammalian cells |
Applications | Elisa, WB |
Product name | CD58 Recombinant Protein |
---|---|
Uniprot ID | P19256 |
Uniprot link | http://www.uniprot.org/uniprot/P19256 |
Origin species | Homo sapiens (Human) |
Expression system | Eukaryotic expression |
Sequence | MVAGSDAGRALGVLSVVCLLHCFGFISCFSQQIYGVVYGNVTFHVPSNVPLKEVLWKKQKDKVAELENSEFRAFSSFKNRVYLDTVSGSLTIYNLTSSDEDEYEMESPNITDTMKFFLYVLESLPSPTLTCALTNGSIEVQCMIPEHYNSHRGLIMYSWDCPMEQCKRNSTSIYFKMENDLPQKIQCTLSNPLFNTTSSIILTTCIPSSGHSRHR |
Molecular weight | 40kDa |
Protein delivered with Tag? | C-terminal His Tag |
Purity estimated | >90% by SDS-PAGE |
Buffer | PBS, pH7.5 |
Form | Frozen |
Delivery condition | Dry Ice |
Delivery lead time in business days | Europe: 5-7 working days USA & Canada: 7-10 working days Rest of the world: 5-12 working days |
Storage condition | Store at - 20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. |
Brand | ProteoGenix |
Host species | Mammalian cells |
Fragment Type | Met1~Arg215 |
Protein Accession | P19256 |
Spec:Entrez GeneID | 965 |
Spec:NCBI Gene Aliases | ag3; LFA3; LFA-3 |
Spec:SwissProtID | Q5U053 |
NCBI Reference | P19256 |
Aliases /Synonyms | LFA3, Ag3 |
Reference | PX-P4086 |
Note | For research use only |
Send us a message from the form below
Reviews
There are no reviews yet.