Cart (0 Items)
Your cart is currently empty.
View Products
| size | 100ug |
|---|---|
| Brand | ProteoGenix |
| Product type | Recombinant Proteins |
| Host Species | Mammalian cells |
| Applications | Elisa, WB |
| Product name | CD66e Recombinant Protein |
|---|---|
| Uniprot ID | P06731 |
| Uniprot link | http://www.uniprot.org/uniprot/P06731 |
| Origin species | Homo sapiens (Human) |
| Expression system | Eukaryotic expression |
| Sequence | MESPSAPPHRWCIPWQRLLLTASLLTFWNPPTTAKLTIESTPFNVAEGKEVLLLVHNLPQHLFGYSWYKGERVDGNRQIIGYVIGTQQATPGPAYSGREIIYPNASLLIQNIIQNDTGFYTLHVIKSDLVNEEATGQFRVYPELPKPSISSNNSKPVEDKDAVAFTCEPETQDATYLWWVNNQSLPVSPRLQLSNGNRTLTLFNVTRNDSASYKCETQNPVSARRSDSVILNVLYGPDAPTISPLNTSYRSGENLNLSCHAASNPPAQYSWFVNGTFQQSTQELFIPNITVNNSGSYTCQAHNSDTGLNRTTVTTITVYAEPPKPFITSNNSNPVEDEDAVALTCEPEIQNTTYLWWVNNQSLPVSPRLQLSNDNRTLTLLSVTRNDVGPYECGIQNELSVDHSDPVILNVLYGPDDPTISPSYTYYRPGVNLSLSCHAASNPPAQYSWLIDGNIQQHTQELFISNITEKNSGLYTCQANNSASGHSRTTVKTITVSAELPKPSISSNNSKPVEDKDAVAFTCEPEAQNTTYLWWVNGQSLPVSPRLQLSNGNRTLTLFNVTRNDARAYVCGIQNSVSANRSDPVTLDVLYGPDTPIISPPDSSYLSGANLNLSCHSASNPSPQYSWRINGIPQQHTQVLFIAKITPNNNGTYACFVSNLATGRNNSIVKSITVSASGTSPGLSA |
| Molecular weight | 130kDa |
| Protein delivered with Tag? | C-terminal His Tag |
| Purity estimated | >90% by SDS-PAGE |
| Buffer | PBS pH7.5 |
| Delivery condition | Dry Ice |
| Delivery lead time in business days | 3-5 days if in stock; 3-5 weeks if production needed |
| Storage condition | Store at - 20℃ to -80℃.It is recommended that the protein be aliquoted for optimal storage. |
| Brand | ProteoGenix |
| Host species | Mammalian cells |
| Fragment Type | Met1~Ala685 |
| Aliases /Synonyms | CEA |
| Reference | PX-P4089 |
| Note | For research use only. |
Carcinoembryonic antigen related cell adhesion molecule 5 (CEACAM5) is also carcinoembryonic antigen (CEA), meconium antigen 100, CD antigen CD66e, CEACAM5 belongs to the immunoglobulin superfamily and CEA family. CEACAM5 contains seven Ig-like (immunoglobulin-like) domains. CEACAM5/CD66e is a homodimeric protein and its binding to E. coli Dr adhesin results in the dispersion of homodimers. CEACAM5 is a cell surface glycoprotein that plays a role in cell adhesion and intracellular signal transduction.
Immobilized CD66e Recombinant Protein (cat. No.PX-P4089) at 0.5µg/mL (100µL/well) can bind to Labetuzumab Biosimilar - Anti-CEACAM5 mAb (cat. No.PX-TA1048) in indirect ELISA with Goat Anti-Human IgG secondary antibody coupled with HRP measured by OD450
Immobilized CD66e Recombinant Protein (cat. No.PX-P4089) at 0.5µg/mL (100µL/well) can bind Cibisatamab Biosimilar - Anti-CEACAM5andCD3E;CD3E mAb - Research Grade (cat. No.PX-TA1824) in indirect ELISA with Goat Anti-Human IgG secondary antibody coupled with HRP measured by OD450 giving an EC50 at 3.461M.
Immobilized CD66e Recombinant Protein (cat. No.PX-P4089) at 0.5µg/mL (100µL/well) can bind Arcitumomab Biosimilar - Anti-CD66e;CEA mAb - Research Grade (cat. No.PX-TA1077) in indirect ELISA with Goat Anti-Human IgG secondary antibody coupled with HRP measured by OD450 giving an EC50 at 13.80M.
Immobilized CD66e Recombinant Protein (cat. No.PX-P4089) at 0.5µg/mL (100µL/well) can bind to Cergutuzumab Biosimilar - Anti-CEACAM5, CEA, CD66e mAb (cat. No.PX-TA1387) in indirect ELISA with Goat Anti-Human IgG secondary antibody coupled with HRP measured by OD450
Related products
Send us a message from the form below
Reviews
There are no reviews yet.