Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Besilesomab Biosimilar – Anti-CEACAM8, CD66b mAb – Research Grade

  • PX-TA1184-50
  • Validated ELISA
Clonality:
Monoclonal Antibody
Isotype:
IgG1, kappa

Original price was: $203.00.Current price is: $167.00.

50ug 18% OFF + 167 loyalty points
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Besilesomab Biosimilar - Anti-CEACAM8, CD66b mAb - Research Grade

Product name Besilesomab Biosimilar - Anti-CEACAM8, CD66b mAb - Research Grade
Uniprot ID P31997
Source CAS 537694-98-7
Species Mus musculus
Raw Antigen Sequence MGPISAPSCRWRIPWQGLLLTASLFTFWNPPTTAQLTIEAVPSNAAEGKEVLLLVHNLPQDPRGYNWYKGETVDANRRIIGYVISNQQITPGPAYSNRETIYPNASLLMRNVTRNDTGSYTLQVIKLNLMSEEVTGQFSVHPETPKPSISSNNSNPVEDKDAVAFTCEPETQNTTYLWWVNGQSLPVSPRLQLSNGNRTLTLLSVTRNDVGPYECEIQNPASANFSDPVTLNVLYGPDAPTISPSDTYYHAGVNLNLSCHAASNPPSQYSWSVNGTFQQYTQKLFIPNITTKNSGSYACHTTNSATGRNRTTVRMITVSDALVQGSSPGLSARATVSIMIGVLARVALI
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB
Aliases /Synonyms Besilesomab,BW250/183,CEACAM8, CD66b,anti-CEACAM8, CD66b
Reference PX-TA1184
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1-kappa
Clonality Monoclonal Antibody
Product name Besilesomab Biosimilar - Anti-CEACAM8, CD66b mAb - Research Grade
Uniprot ID P31997
Source CAS 537694-98-7
Species Mus musculus
Raw Antigen Sequence MGPISAPSCRWRIPWQGLLLTASLFTFWNPPTTAQLTIEAVPSNAAEGKEVLLLVHNLPQDPRGYNWYKGETVDANRRIIGYVISNQQITPGPAYSNRETIYPNASLLMRNVTRNDTGSYTLQVIKLNLMSEEVTGQFSVHPETPKPSISSNNSNPVEDKDAVAFTCEPETQNTTYLWWVNGQSLPVSPRLQLSNGNRTLTLLSVTRNDVGPYECEIQNPASANFSDPVTLNVLYGPDAPTISPSDTYYHAGVNLNLSCHAASNPPSQYSWSVNGTFQQYTQKLFIPNITTKNSGSYACHTTNSATGRNRTTVRMITVSDALVQGSSPGLSARATVSIMIGVLARVALI
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB,,,
Aliases /Synonyms Besilesomab,BW250/183,CEACAM8, CD66b,anti-CEACAM8, CD66b
Reference PX-TA1184
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1-kappa
Clonality Monoclonal Antibody
Product name PX-TA1184-50
Uniprot ID P31997
Source CAS 537694-98-7
Species Mus musculus
Raw Antigen Sequence MGPISAPSCRWRIPWQGLLLTASLFTFWNPPTTAQLTIEAVPSNAAEGKEVLLLVHNLPQDPRGYNWYKGETVDANRRIIGYVISNQQITPGPAYSNRETIYPNASLLMRNVTRNDTGSYTLQVIKLNLMSEEVTGQFSVHPETPKPSISSNNSNPVEDKDAVAFTCEPETQNTTYLWWVNGQSLPVSPRLQLSNGNRTLTLLSVTRNDVGPYECEIQNPASANFSDPVTLNVLYGPDAPTISPSDTYYHAGVNLNLSCHAASNPPSQYSWSVNGTFQQYTQKLFIPNITTKNSGSYACHTTNSATGRNRTTVRMITVSDALVQGSSPGLSARATVSIMIGVLARVALI
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Aliases /Synonyms Besilesomab,BW250/183,CEACAM8, CD66b,anti-CEACAM8, CD66b
Reference PX-TA1184
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1, kappa
Clonality Monoclonal Antibody

Introduction to Besilesomab Biosimilar – Anti-CEACAM8, CD66b mAb

Besilesomab Biosimilar, also known as Anti-CEACAM8, CD66b mAb, is a monoclonal antibody that has been developed as a biosimilar to the original drug, Besilesomab. This biosimilar has been designed to target the CEACAM8 protein, also known as CD66b, which is found on the surface of neutrophils. In this article, we will discuss the structure, activity, and potential applications of Besilesomab Biosimilar.

Structure of Besilesomab Biosimilar

Besilesomab Biosimilar is a recombinant humanized monoclonal antibody. It is composed of two identical heavy chains and two identical light chains, each containing a variable region and a constant region. The variable region is responsible for binding to the CEACAM8 protein, while the constant region is responsible for effector functions such as antibody-dependent cellular cytotoxicity and complement-dependent cytotoxicity.

The structure of Besilesomab Biosimilar is highly similar to the original drug, Besilesomab, as it is designed to mimic its function. However, slight differences in the amino acid sequence may affect its binding affinity and potency.

Activity of Besilesomab Biosimilar

Besilesomab Biosimilar specifically targets the CEACAM8 protein, which is found on the surface of neutrophils. This protein plays a crucial role in the activation and migration of neutrophils to sites of infection or inflammation. By binding to CEACAM8, Besilesomab Biosimilar can block its activity and prevent the recruitment of neutrophils to the site of inflammation.

In addition, Besilesomab Biosimilar can also induce antibody-dependent cellular cytotoxicity, where the antibody binds to the CEACAM8 protein on the surface of neutrophils and triggers their destruction by immune cells. This activity can help to reduce the number of neutrophils at the site of inflammation, thereby reducing tissue damage and promoting healing.

Therapeutic Target of Besilesomab Biosimilar

The therapeutic target of Besilesomab Biosimilar is the CEACAM8 protein, which is found on the surface of neutrophils. Neutrophils play a crucial role in the body’s immune response, particularly in the early stages of inflammation and infection. However, excessive activation and recruitment of neutrophils can lead to tissue damage and contribute to the progression of various inflammatory diseases.

By targeting CEACAM8, Besilesomab Biosimilar can modulate the activity of neutrophils and help to reduce their harmful effects. This makes it a potential therapeutic option for various inflammatory conditions such as rheumatoid arthritis, psoriasis, and inflammatory bowel disease.

Title: Potential Applications of Besilesomab Biosimilar

Besilesomab Biosimilar is currently being evaluated in clinical trials for the treatment of rheumatoid arthritis and psoriasis. These conditions are characterized by chronic inflammation, and the targeting of CEACAM8 with Besilesomab Biosimilar has shown promising results in reducing disease activity and improving symptoms.

In addition, Besilesomab Biosimilar may also have potential applications in the treatment of other inflammatory diseases such as inflammatory bowel disease, sepsis, and acute respiratory distress syndrome. Further research is needed to fully understand the potential of this biosimilar in these conditions.

Conclusion:

Besilesomab Biosimilar, also known as Anti-CEACAM8, CD66b mAb, is a monoclonal antibody that targets the CEACAM8 protein on the surface of neutrophils. By binding to this protein, Besilesomab Biosimilar can modulate the activity of neutrophils and has potential applications in the treatment of various inflammatory conditions. Its structure, activity, and potential therapeutic target make it a promising biosimilar in the field of immunotherapy.

Besilesomab Biosimilar - Anti-CD66b;CEACAM8 mAb - Research Grade in ELISA Assay

Besilesomab Biosimilar - Anti-CD66b;CEACAM8 mAb - Research Grade in ELISA Assay

Besilesomab Biosimilar - Anti-CD66b;CEACAM8 mAb - Research Grade can bind to its target in indirect ELISA with Goat secondary antibody measured by OD450.

SDS-PAGE for Besilesomab Biosimilar - Anti-CD66b;CEACAM8 mAb - Research Grade

SDS-PAGE for Besilesomab Biosimilar - Anti-CD66b;CEACAM8 mAb - Research Grade

Besilesomab Biosimilar - Anti-CD66b;CEACAM8 mAb - Research Grade, on SDS-PAGE. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

Besilesomab Biosimilar - Anti-CEACAM8, CD66b mAb - Research Grade

There are no reviews yet.

Be the first to review “Besilesomab Biosimilar – Anti-CEACAM8, CD66b mAb – Research Grade”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products