Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Altumomab Biosimilar – Anti-CEACAM5, CD66e mAb – Research Grade

  • PX-TA1224-50
  • Validated ELISA WB
Clonality:
Monoclonal Antibody
Isotype:
IgG1-nd

Original price was: $226.00.Current price is: $167.00.

50ug 26% OFF + 167 loyalty points
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Altumomab Biosimilar - Anti-CEACAM5, CD66e mAb - Research Grade

Product name Altumomab Biosimilar - Anti-CEACAM5, CD66e mAb - Research Grade
Uniprot ID P06731
Source CAS 156586-92-4
Species Mus musculus
Raw Antigen Sequence MESPSAPPHRWCIPWQRLLLTASLLTFWNPPTTAKLTIESTPFNVAEGKEVLLLVHNLPQHLFGYSWYKGERVDGNRQIIGYVIGTQQATPGPAYSGREIIYPNASLLIQNIIQNDTGFYTLHVIKSDLVNEEATGQFRVYPELPKPSISSNNSKPVEDKDAVAFTCEPETQDATYLWWVNNQSLPVSPRLQLSNGNRTLTLFNVTRNDTASYKCETQNPVSARRSDSVILNVLYGPDAPTISPLNTSYRSGENLNLSCHAASNPPAQYSWFVNGTFQQSTQELFIPNITVNNSGSYTCQAHNSDTGLNRTTVTTITVYAEPPKPFITSNNSNPVEDEDAVALTCEPEIQNTTYLWWVNNQSLPVSPRLQLSNDNRTLTLLSVTRNDVGPYECGIQNELSVDHSDPVILNVLYGPDDPTISPSYTYYRPGVNLSLSCHAASNPPAQYSWLIDGNIQQHTQELFISNITEKNSGLYTCQANNSASGHSRTTVKTITVSAELPKPSISSNNSKPVEDKDAVAFTCEPEAQNTTYLWWVNGQSLPVSPRLQLSNGNRTLTLFNVTRNDARAYVCGIQNSVSANRSDPVTLDVLYGPDTPIISPPDSSYLSGANLNLSCHSASNPSPQYSWRINGIPQQHTQVLFIAKITPNNNGTYACFVSNLATGRNNSIVKSITVSASGTSPGLSAGATVGIMIGVLVGVALI
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB
Aliases /Synonyms Altumomab,ZCE025,CEACAM5, CD66e,anti-CEACAM5, CD66e
Reference PX-TA1224
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1-nd
Clonality Monoclonal Antibody
Product name Altumomab Biosimilar - Anti-CEACAM5, CD66e mAb - Research Grade
Uniprot ID P06731
Source CAS 156586-92-4
Species Mus musculus
Raw Antigen Sequence MESPSAPPHRWCIPWQRLLLTASLLTFWNPPTTAKLTIESTPFNVAEGKEVLLLVHNLPQHLFGYSWYKGERVDGNRQIIGYVIGTQQATPGPAYSGREIIYPNASLLIQNIIQNDTGFYTLHVIKSDLVNEEATGQFRVYPELPKPSISSNNSKPVEDKDAVAFTCEPETQDATYLWWVNNQSLPVSPRLQLSNGNRTLTLFNVTRNDTASYKCETQNPVSARRSDSVILNVLYGPDAPTISPLNTSYRSGENLNLSCHAASNPPAQYSWFVNGTFQQSTQELFIPNITVNNSGSYTCQAHNSDTGLNRTTVTTITVYAEPPKPFITSNNSNPVEDEDAVALTCEPEIQNTTYLWWVNNQSLPVSPRLQLSNDNRTLTLLSVTRNDVGPYECGIQNELSVDHSDPVILNVLYGPDDPTISPSYTYYRPGVNLSLSCHAASNPPAQYSWLIDGNIQQHTQELFISNITEKNSGLYTCQANNSASGHSRTTVKTITVSAELPKPSISSNNSKPVEDKDAVAFTCEPEAQNTTYLWWVNGQSLPVSPRLQLSNGNRTLTLFNVTRNDARAYVCGIQNSVSANRSDPVTLDVLYGPDTPIISPPDSSYLSGANLNLSCHSASNPSPQYSWRINGIPQQHTQVLFIAKITPNNNGTYACFVSNLATGRNNSIVKSITVSASGTSPGLSAGATVGIMIGVLVGVALI
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB,,,
Aliases /Synonyms Altumomab,ZCE025,CEACAM5, CD66e,anti-CEACAM5, CD66e
Reference PX-TA1224
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1-nd
Clonality Monoclonal Antibody
Product name PX-TA1224-50
Uniprot ID P06731
Source CAS 156586-92-4
Species Mus musculus
Raw Antigen Sequence MESPSAPPHRWCIPWQRLLLTASLLTFWNPPTTAKLTIESTPFNVAEGKEVLLLVHNLPQHLFGYSWYKGERVDGNRQIIGYVIGTQQATPGPAYSGREIIYPNASLLIQNIIQNDTGFYTLHVIKSDLVNEEATGQFRVYPELPKPSISSNNSKPVEDKDAVAFTCEPETQDATYLWWVNNQSLPVSPRLQLSNGNRTLTLFNVTRNDTASYKCETQNPVSARRSDSVILNVLYGPDAPTISPLNTSYRSGENLNLSCHAASNPPAQYSWFVNGTFQQSTQELFIPNITVNNSGSYTCQAHNSDTGLNRTTVTTITVYAEPPKPFITSNNSNPVEDEDAVALTCEPEIQNTTYLWWVNNQSLPVSPRLQLSNDNRTLTLLSVTRNDVGPYECGIQNELSVDHSDPVILNVLYGPDDPTISPSYTYYRPGVNLSLSCHAASNPPAQYSWLIDGNIQQHTQELFISNITEKNSGLYTCQANNSASGHSRTTVKTITVSAELPKPSISSNNSKPVEDKDAVAFTCEPEAQNTTYLWWVNGQSLPVSPRLQLSNGNRTLTLFNVTRNDARAYVCGIQNSVSANRSDPVTLDVLYGPDTPIISPPDSSYLSGANLNLSCHSASNPSPQYSWRINGIPQQHTQVLFIAKITPNNNGTYACFVSNLATGRNNSIVKSITVSASGTSPGLSAGATVGIMIGVLVGVALI
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Aliases /Synonyms Altumomab,ZCE025,CEACAM5, CD66e,anti-CEACAM5, CD66e
Reference PX-TA1224
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1-nd
Clonality Monoclonal Antibody

Introduction:

Altumomab Biosimilar – Anti-CEACAM5, CD66e mAb – Research Grade is a monoclonal antibody that has been developed as a biosimilar to the original antibody, Altumomab. This antibody specifically targets CEACAM5, also known as CD66e, a cell surface protein that is overexpressed in various types of cancers. In this article, we will discuss the structure, activity, and potential applications of this biosimilar.

Structure:

Altumomab Biosimilar – Anti-CEACAM5, CD66e mAb – Research Grade is a recombinant monoclonal antibody that is produced in a mammalian cell expression system. It is composed of two heavy chains and two light chains, each containing a variable region that specifically binds to CEACAM5. The antibody has a molecular weight of approximately 150 kDa and belongs to the IgG1 isotype.

Activity:

The primary function of Altumomab Biosimilar – Anti-CEACAM5, CD66e mAb – Research Grade is to bind to CEACAM5, a cell surface glycoprotein that is overexpressed in various types of cancer cells. This binding inhibits the growth and survival of cancer cells, making it a potential therapeutic target for cancer treatment. Additionally, this biosimilar has been shown to induce antibody-dependent cellular cytotoxicity (ADCC) and complement-dependent cytotoxicity (CDC), further enhancing its anti- cancer activity.

Application:

Due to its specific targeting of CEACAM5, Altumomab Biosimilar – Anti-CEACAM5, CD66e mAb – Research Grade has potential applications in the treatment of various types of cancer, including colorectal, lung, and breast cancer. It can be used as a standalone therapy or in combination with other cancer treatments, such as chemotherapy or radiation therapy.

Research Grade:

Altumomab Biosimilar – Anti-CEACAM5, CD66e mAb – Research Grade is specifically designed for use in research and development purposes. It is not intended for therapeutic use in humans, but rather for in vitro and in vivo studies to further understand its mechanism of action and potential applications. This research grade biosimilar is produced under strict quality control measures to ensure its purity and consistency.

Advantages:

Compared to the original Altumomab antibody, the biosimilar offers several advantages. Firstly, it is more cost-effective, making it more accessible for research and development purposes. Secondly, it has a higher binding affinity to CEACAM5, leading to a stronger anti- cancer activity. Lastly, as a biosimilar, it has been extensively studied and has shown similar efficacy and safety profiles to the original antibody.

Conclusion:

In summary, Altumomab Biosimilar – Anti-CEACAM5, CD66e mAb – Research Grade is a recombinant monoclonal antibody that specifically targets CEACAM5, a cell surface protein overexpressed in various types of cancer. Its structure, activity, and potential applications make it a promising biosimilar for cancer treatment. Further research and development are needed to fully understand its potential and to bring it to the market as a therapeutic option for cancer patients.

Altumomab Biosimilar - Anti-CD66e;CEA mAb - Research Grade in ELISA Assay

Altumomab Biosimilar - Anti-CD66e;CEA mAb - Research Grade in ELISA Assay

Altumomab Biosimilar - Anti-CD66e;CEA mAb - Research Grade can bind to its target in indirect ELISA with Goat secondary antibody measured by OD450.

Altumomab Biosimilar - Anti-CD66e;CEA mAb - Research Grade in WB Assay

Altumomab Biosimilar - Anti-CD66e;CEA mAb - Research Grade in WB Assay

Altumomab Biosimilar - Anti-CD66e;CEA mAb - Research Grade can bind to its target in Western Blot Assay as detected on gel analysis.

SDS-PAGE for Altumomab Biosimilar - Anti-CD66e;CEA mAb - Research Grade

SDS-PAGE for Altumomab Biosimilar - Anti-CD66e;CEA mAb - Research Grade

Altumomab Biosimilar - Anti-CD66e;CEA mAb - Research Grade, on SDS-PAGE. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

Altumomab Biosimilar - Anti-CEACAM5, CD66e mAb - Research Grade

There are no reviews yet.

Be the first to review “Altumomab Biosimilar – Anti-CEACAM5, CD66e mAb – Research Grade”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products