Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Tinurilimab Biosimilar – Anti-CEACAM6 mAb – Research Grade

Isotype:
IgG1, kappa

Original price was: $134.00.Current price is: $100.00.

50ug 25% OFF + 100 loyalty points
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Tinurilimab Biosimilar - Anti-CEACAM6 mAb - Research Grade

Product name Tinurilimab Biosimilar - Anti-CEACAM6 mAb - Research Grade
Uniprot ID P40199
Species Humanized
Raw Antigen Sequence MGPPSAPPCRLHVPWKEVLLTASLLTFWNPPTTAKLTIESTPFNVAEGKEVLLLAHNLPQNRIGYSWYKGERVDGNSLIVGYVIGTQQATPGPAYSGRETIYPNASLLIQNVTQNDTGFYTLQVIKSDLVNEEATGQFHVYPELPKPSISSNNSNPVEDKDAVAFTCEPEVQNTTYLWWVNGQSLPVSPRLQLSNGNMTLTLLSVKRNDAGSYECEIQNPASANRSDPVTLNVLYGPDVPTISPSKANYRPGENLNLSCHAASNPPAQYSWFINGTFQQSTQELFIPNITVNNSGSYMCQAHNSATGLNRTTVTMITVSGSAPVLSAVATVGITIGVLARVALI
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Aliases /Synonyms Tinurilimab ,BAY-1834942,CEACAM6,anti-CEACAM6
Reference PX-TA1609
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1, kappa
Product name Tinurilimab Biosimilar - Anti-CEACAM6 mAb - Research Grade
Uniprot ID P40199
Species Humanized
Raw Antigen Sequence MGPPSAPPCRLHVPWKEVLLTASLLTFWNPPTTAKLTIESTPFNVAEGKEVLLLAHNLPQNRIGYSWYKGERVDGNSLIVGYVIGTQQATPGPAYSGRETIYPNASLLIQNVTQNDTGFYTLQVIKSDLVNEEATGQFHVYPELPKPSISSNNSNPVEDKDAVAFTCEPEVQNTTYLWWVNGQSLPVSPRLQLSNGNMTLTLLSVKRNDAGSYECEIQNPASANRSDPVTLNVLYGPDVPTISPSKANYRPGENLNLSCHAASNPPAQYSWFINGTFQQSTQELFIPNITVNNSGSYMCQAHNSATGLNRTTVTMITVSGSAPVLSAVATVGITIGVLARVALI
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Aliases /Synonyms Tinurilimab ,BAY-1834942,CEACAM6,anti-CEACAM6
Reference PX-TA1609
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1, kappa
Product name PX-TA1609-50
Uniprot ID P40199
Species Humanized
Raw Antigen Sequence MGPPSAPPCRLHVPWKEVLLTASLLTFWNPPTTAKLTIESTPFNVAEGKEVLLLAHNLPQNRIGYSWYKGERVDGNSLIVGYVIGTQQATPGPAYSGRETIYPNASLLIQNVTQNDTGFYTLQVIKSDLVNEEATGQFHVYPELPKPSISSNNSNPVEDKDAVAFTCEPEVQNTTYLWWVNGQSLPVSPRLQLSNGNMTLTLLSVKRNDAGSYECEIQNPASANRSDPVTLNVLYGPDVPTISPSKANYRPGENLNLSCHAASNPPAQYSWFINGTFQQSTQELFIPNITVNNSGSYMCQAHNSATGLNRTTVTMITVSGSAPVLSAVATVGITIGVLARVALI
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Aliases /Synonyms Tinurilimab ,BAY-1834942,CEACAM6,anti-CEACAM6
Reference PX-TA1609
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1, kappa
Product name Tinurilimab Biosimilar - Anti-CEACAM6 mAb - Research Grade
Uniprot ID P40199
Species Humanized
Raw Antigen Sequence MGPPSAPPCRLHVPWKEVLLTASLLTFWNPPTTAKLTIESTPFNVAEGKEVLLLAHNLPQNRIGYSWYKGERVDGNSLIVGYVIGTQQATPGPAYSGRETIYPNASLLIQNVTQNDTGFYTLQVIKSDLVNEEATGQFHVYPELPKPSISSNNSNPVEDKDAVAFTCEPEVQNTTYLWWVNGQSLPVSPRLQLSNGNMTLTLLSVKRNDAGSYECEIQNPASANRSDPVTLNVLYGPDVPTISPSKANYRPGENLNLSCHAASNPPAQYSWFINGTFQQSTQELFIPNITVNNSGSYMCQAHNSATGLNRTTVTMITVSGSAPVLSAVATVGITIGVLARVALI
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB
Aliases /Synonyms Tinurilimab ,BAY-1834942,CEACAM6,anti-CEACAM6
Reference PX-TA1609
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1-kappa
Clonality Monoclonal Antibody
Product name Tinurilimab Biosimilar - Anti-CEACAM6 mAb - Research Grade
Uniprot ID P40199
Species Humanized
Raw Antigen Sequence MGPPSAPPCRLHVPWKEVLLTASLLTFWNPPTTAKLTIESTPFNVAEGKEVLLLAHNLPQNRIGYSWYKGERVDGNSLIVGYVIGTQQATPGPAYSGRETIYPNASLLIQNVTQNDTGFYTLQVIKSDLVNEEATGQFHVYPELPKPSISSNNSNPVEDKDAVAFTCEPEVQNTTYLWWVNGQSLPVSPRLQLSNGNMTLTLLSVKRNDAGSYECEIQNPASANRSDPVTLNVLYGPDVPTISPSKANYRPGENLNLSCHAASNPPAQYSWFINGTFQQSTQELFIPNITVNNSGSYMCQAHNSATGLNRTTVTMITVSGSAPVLSAVATVGITIGVLARVALI
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB,,,
Aliases /Synonyms Tinurilimab ,BAY-1834942,CEACAM6,anti-CEACAM6
Reference PX-TA1609
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1-kappa
Clonality Monoclonal Antibody

The Structure, Activity and

Application of Tinurilimab Biosimilar – Anti-CEACAM6 mAb – Research Grade

The Structure of Tinurilimab Biosimilar

Tinurilimab Biosimilar, also known as Anti-CEACAM6 mAb, is a monoclonal antibody that is designed to target the carcinoembryonic antigen-related cell adhesion molecule 6 (CEACAM6). It is a biosimilar version of the original Tinurilimab, which has been approved for use in the treatment of certain types of cancer.

The structure of Tinurilimab Biosimilar is similar to that of the original Tinurilimab, with a few minor differences. It is composed of two heavy chains and two light chains, which are linked together by disulfide bonds. The heavy chains consist of a constant region and a variable region, while the light chains consist of only a variable region. The variable regions are responsible for the specificity of the antibody, as they bind to the target molecule, CEACAM6.

The Activity of Tinurilimab Biosimilar

Tinurilimab Biosimilar works by binding to CEACAM6, which is a cell surface glycoprotein that is overexpressed in many types of cancer cells. By binding to CEACAM6, Tinurilimab Biosimilar prevents the interaction of CEACAM6 with other molecules, which is necessary for cancer cell growth and survival. This ultimately leads to the inhibition of cancer cell growth and the induction of cell death.

In addition to its direct anti-

cancer activity, Tinurilimab Biosimilar also has immunomodulatory effects. It can activate immune cells, such as natural killer cells and macrophages, to recognize and attack cancer cells. This further enhances its anti- cancer activity and makes it a promising therapeutic option for cancer treatment.

The Application of Tinurilimab Biosimilar

Tinurilimab Biosimilar is currently being studied for its potential use in the treatment of various types of cancer, including colorectal, lung, and breast cancer. It is being developed as a research grade antibody, which means that it is intended for use in preclinical studies and clinical trials.

One of the advantages of Tinurilimab Biosimilar is its similarity to the original Tinurilimab, which has already been approved for use in cancer treatment. This means that it has already undergone extensive testing and has a well-established safety profile. This makes it a promising candidate for further development and potential approval for clinical use.

In addition to its potential as a cancer treatment, Tinurilimab Biosimilar may also have applications in other diseases where CEACAM6 is overexpressed, such as inflammatory bowel disease and autoimmune disorders. This highlights the versatility and potential of this antibody in the field of medicine.

Conclusion

In summary, Tinurilimab Biosimilar, also known as Anti-CEACAM6 mAb, is a promising monoclonal antibody that is being developed as a biosimilar version of the original Tinurilimab. Its structure, activity, and potential applications make it a valuable addition to the field of cancer treatment and beyond. Further research and clinical trials are needed to fully understand and harness the potential of this antibody for the benefit of patients.

SDS-PAGE for Tinurilimab Biosimilar - Anti-CEACAM6 mAb - Research Grade

SDS-PAGE for Tinurilimab  Biosimilar - Anti-CEACAM6 mAb - Research Grade

Tinurilimab Biosimilar - Anti-CEACAM6 mAb - Research Grade, on SDS-PAGE. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

Tinurilimab  Biosimilar - Anti-CEACAM6 mAb - Research Grade

There are no reviews yet.

Be the first to review “Tinurilimab Biosimilar – Anti-CEACAM6 mAb – Research Grade”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products