Cart (0 Items)
Your cart is currently empty.
View Products
              
              
              | size | 100ug, 50ug  | 
		
|---|---|
| Brand | ProteoGenix  | 
		
| Product type | Recombinant Proteins  | 
		
| Host Species | Escherichia coli (E. coli)  | 
		
| Applications | Elisa, WB  | 
		
| Product name | Human IGFBP1 Nter Recombinant Protein | 
|---|---|
| Uniprot ID | P08833 | 
| Uniprot link | http://www.uniprot.org/uniprot/P08833 | 
| Origin species | Homo sapiens (Human) | 
| Expression system | Prokaryotic expression | 
| Sequence | MKYLLPTAAAGLLLLAAQPAMA^MDAPWQCAPCSAEKLALCPPVSASCSEVTRSAGCGCCPMCALPLGAACGVATARCARGLSCRALPGEQQPLHALTRGQGACVQESDASAPHAAEAGSPESPESTEITEEELLDNFHLMAPSEEDHSILWDAISTYDGSKLEHHHHHH | 
| Molecular weight | 17.59 kD | 
| Purity estimated | 85% | 
| Buffer | PBS, pH 7.5 with 0.2mM β-Met | 
| Form | Lyophilized | 
| Delivery condition | Dry Ice | 
| Delivery lead time in business days | 10-25 | 
| Storage condition | 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection) | 
| Brand | ProteoGenix | 
| Host species | Escherichia coli (E.coli) | 
| Fragment Type | Partial | 
| Protein Accession | ACO37638.1 | 
| Spec:Entrez GeneID | 3484 | 
| Spec:NCBI Gene Aliases | hIGFBP-1, AFBP, IBP1, PP12, IGF-BP25 | 
| Spec:SwissProtID | P08833 | 
| NCBI Reference | ACO37638.1 | 
| Aliases /Synonyms | IGFBP1 Nter, insulin-like Growth Factor proteins binding protein 1, Insulin-like Growth Factor proteins-binding protein 1 | 
| Reference | PX-P2078 | 
| Note | For research use only | 
Related products
Send us a message from the form below
Reviews
There are no reviews yet.