Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

InVivoMAb Anti-Human IFN α2/IFNA2 (Iv0001)

  • ARO-A13372-50
  • Validated ELISA FC WB
Clonality:
Monoclonal Antibody
Host species:
Human

Original price was: $420.00.Current price is: $305.00.

50ug 27% OFF + 305 loyalty points
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

InVivoMAb Anti-Human IFN α2/IFNA2 (Iv0001)

Product name ARO-A13372-100
Uniprot ID P01563
Raw Antigen Sequence MALTFALLVALLVLSCKSSCSVGCDLPQTHSLGSRRTLMLLAQMRRISLFSCLKDRHDFGFPQEEFGNQFQKAETIPVLHEMIQQIFNLFSTKDSSAAWDETLLDKFYTELYQQLNDLEACVIQGVGVTETPLMKEDSILAVRKYFQRITLYLKEKKYSPCAWEVVRAEIMRSFSLSTNLQESLRSKE
Buffer 0.01M PBS, pH 7.4.
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition Use a manual defrost freezer and avoid repeated freeze thaw cycles.Store at 4°C for frequent use.Store at -20 to -80 °C for twelve months from the date of receipt.
Brand ProteoGenix
Host species Human
Aliases /Synonyms Anti-IFNA2, Interferon alpha-2, IFN-alpha-2, Interferon alpha-A, LeIF A, IFN-Alpha, IFNA2A, IFNA2B, IFNA2C, Interferon alpha-1/13, IFN-alpha-1/13, Interferon alpha-D, LeIF D, IFNA1, IFNA13, IFN-α4, IFN-α5, IFN-α6, IFN-α7, IFN-α8, IFN-αl0, IFN-α14, IFN-α16, IFN-α17, IFN-α21
Reference ARO-A13372
Clonality Monoclonal Antibody
Protein Name IFNA2
Product name ARO-A13372-1MG
Uniprot ID P01563
Raw Antigen Sequence MALTFALLVALLVLSCKSSCSVGCDLPQTHSLGSRRTLMLLAQMRRISLFSCLKDRHDFGFPQEEFGNQFQKAETIPVLHEMIQQIFNLFSTKDSSAAWDETLLDKFYTELYQQLNDLEACVIQGVGVTETPLMKEDSILAVRKYFQRITLYLKEKKYSPCAWEVVRAEIMRSFSLSTNLQESLRSKE
Buffer 0.01M PBS, pH 7.4.
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition Use a manual defrost freezer and avoid repeated freeze thaw cycles.Store at 4°C for frequent use.Store at -20 to -80 °C for twelve months from the date of receipt.
Brand ProteoGenix
Host species Human
Aliases /Synonyms Anti-IFNA2, Interferon alpha-2, IFN-alpha-2, Interferon alpha-A, LeIF A, IFN-Alpha, IFNA2A, IFNA2B, IFNA2C, Interferon alpha-1/13, IFN-alpha-1/13, Interferon alpha-D, LeIF D, IFNA1, IFNA13, IFN-α4, IFN-α5, IFN-α6, IFN-α7, IFN-α8, IFN-αl0, IFN-α14, IFN-α16, IFN-α17, IFN-α21
Reference ARO-A13372
Clonality Monoclonal Antibody
Protein Name IFNA2
Product name ARO-A13372-50
Uniprot ID P01563
Raw Antigen Sequence MALTFALLVALLVLSCKSSCSVGCDLPQTHSLGSRRTLMLLAQMRRISLFSCLKDRHDFGFPQEEFGNQFQKAETIPVLHEMIQQIFNLFSTKDSSAAWDETLLDKFYTELYQQLNDLEACVIQGVGVTETPLMKEDSILAVRKYFQRITLYLKEKKYSPCAWEVVRAEIMRSFSLSTNLQESLRSKE
Buffer 0.01M PBS, pH 7.4.
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition Use a manual defrost freezer and avoid repeated freeze thaw cycles.Store at 4°C for frequent use.Store at -20 to -80 °C for twelve months from the date of receipt.
Brand ProteoGenix
Host species Human
Aliases /Synonyms Anti-IFNA2, Interferon alpha-2, IFN-alpha-2, Interferon alpha-A, LeIF A, IFN-Alpha, IFNA2A, IFNA2B, IFNA2C, Interferon alpha-1/13, IFN-alpha-1/13, Interferon alpha-D, LeIF D, IFNA1, IFNA13, IFN-α4, IFN-α5, IFN-α6, IFN-α7, IFN-α8, IFN-αl0, IFN-α14, IFN-α16, IFN-α17, IFN-α21
Reference ARO-A13372
Clonality Monoclonal Antibody
Protein Name IFNA2

Flow Cytometry results for InVivoMAb Anti-Human IFN α2/IFNA2 (Iv0001)

Flow Cytometry results for InVivoMAb Anti-Human IFN α2/IFNA2 (Iv0001)

Flow-cytometry using anti-human IFN α2 antibody.HeLa cells were stained with an irrelevant antibody (Blue Histogram) or an anti-human IFN α2 antibody monoclonal antibody (Catalog # ARO-A13372 ,Green Histogram) at a concentration of 5 µg/ml for 30 mins at RT. After washing, bound antibody was detected using a FITC conjugated goat anti-human antibody (Catalog # PTX18862) and cells analysed on a NovoCyte Flow Cytometer.

InVivoMAb Anti-Human IFN α2/IFNA2 (Iv0001) binds to Recombinant Human IFNA2/IFN-alpha-2 Protein, N-His in ELISA Assay

InVivoMAb Anti-Human IFN α2/IFNA2 (Iv0001) binds to Recombinant Human IFNA2/IFN-alpha-2 Protein, N-His in ELISA Assay

Recombinant Human IFNA2/IFN-alpha-2 Protein, N-His(cat. No.ARO-P14545) at 0.5µg/mL (100µL/well) can bind InVivoMAb Anti-Human IFN α2/IFNA2 (Iv0001) in indirect ELISA with Goat secondary antibody measured by OD450.

InVivoMAb Anti-Human IFN α2/IFNA2 (Iv0001) binds to Recombinant Human IFNA2/IFN-alpha-2 Protein, N-His in WB Assay

InVivoMAb Anti-Human IFN α2/IFNA2 (Iv0001) binds to Recombinant Human IFNA2/IFN-alpha-2 Protein, N-His in WB Assay

Recombinant Human IFNA2/IFN-alpha-2 Protein, N-His(cat. No.ARO-P14545) can bind InVivoMAb Anti-Human IFN α2/IFNA2 (Iv0001) in Western Blot Assay as detected on gel analysis.

Flow Cytometry results for InVivoMAb Anti-Human IFN α2/IFNA2 (Iv0001)

Flow Cytometry results for InVivoMAb Anti-Human IFN α2/IFNA2 (Iv0001)

Target Cells were stained with an irrelevant antibody or InVivoMAb Anti-Human IFN α2/IFNA2 (Iv0001) at a concentration of 5 µg/ml for 30 mins at RT. After washing, bound antibody was detected using Goat Anti-Human IgG Polyclonal Antibody, FITC (PTX18862) and cells analysed on a NovoCyte Flow Cytometer.

SDS-PAGE for InVivoMAb Anti-Human IFN α2/IFNA2 (Iv0001)

SDS-PAGE for InVivoMAb Anti-Human IFN α2/IFNA2 (Iv0001)

InVivoMAb Anti-Human IFN α2/IFNA2 (Iv0001), on SDS-PAGE. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

There are no reviews yet.

Be the first to review “InVivoMAb Anti-Human IFN α2/IFNA2 (Iv0001)”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products