Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Flavobacterium columnare clpX, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Flavobacterium columnare
Uniprot ID:
G8X7L0
Molecular weight:
20.2 kDa

Original price was: $276.00.Current price is: $230.00.

50ug 17% OFF + 230 loyalty points
Met1–Ala163
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Flavobacterium columnare clpX, N-His

Product name ARO-P12835-100
Uniprot ID G8X7L0
Origin species Flavobacterium columnare
Expression system Prokaryotic expression
Raw Antigen Sequence MAKEILECSFCGRRKPETNLLIAGIDAHICDHCIEQAHGIVLEELKASGLSKVTDLVLQKPKEIRAFLDKYVIGQEQTKKVISVAVYNHYKRLMQLDHGDDVEIEKSNIIMVGQTGTGKTLVAKTIAKMLDVPLAIVDATVLTEAGYVGEDVESILTRLLQAA
Molecular weight 20.2 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met1-Ala163
Aliases /Synonyms ATP-dependent Clp protease ATP-binding subunit ClpX, clpX, FCOL_04460
Reference ARO-P12835
Note For research use only.
Molecular Constructor
Met1–Ala163
Product name ARO-P12835-1MG
Uniprot ID G8X7L0
Origin species Flavobacterium columnare
Expression system Prokaryotic expression
Raw Antigen Sequence MAKEILECSFCGRRKPETNLLIAGIDAHICDHCIEQAHGIVLEELKASGLSKVTDLVLQKPKEIRAFLDKYVIGQEQTKKVISVAVYNHYKRLMQLDHGDDVEIEKSNIIMVGQTGTGKTLVAKTIAKMLDVPLAIVDATVLTEAGYVGEDVESILTRLLQAA
Molecular weight 20.2 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met1-Ala163
Aliases /Synonyms ATP-dependent Clp protease ATP-binding subunit ClpX, clpX, FCOL_04460
Reference ARO-P12835
Note For research use only.
Molecular Constructor
Met1–Ala163
Product name ARO-P12835-50
Uniprot ID G8X7L0
Origin species Flavobacterium columnare
Expression system Prokaryotic expression
Raw Antigen Sequence MAKEILECSFCGRRKPETNLLIAGIDAHICDHCIEQAHGIVLEELKASGLSKVTDLVLQKPKEIRAFLDKYVIGQEQTKKVISVAVYNHYKRLMQLDHGDDVEIEKSNIIMVGQTGTGKTLVAKTIAKMLDVPLAIVDATVLTEAGYVGEDVESILTRLLQAA
Molecular weight 20.2 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met1-Ala163
Aliases /Synonyms ATP-dependent Clp protease ATP-binding subunit ClpX, clpX, FCOL_04460
Reference ARO-P12835
Note For research use only.
Molecular Constructor
Met1–Ala163

Introduction

Recombinant Flavobacterium columnare clpX is a protein that has gained significant attention in the field of biotechnology and medicine due to its unique structure, activity and potential applications. This protein is derived from the bacterium Flavobacterium columnare, which is known to cause columnaris disease in fish. However, through recombinant DNA technology, the clpX gene from this bacterium has been cloned and expressed in various expression systems, resulting in the production of a highly pure and functional recombinant protein.

Structure of Recombinant Flavobacterium columnare clpX

The clpX gene encodes for a 48 kDa protein, which is composed of 414 amino acids. The recombinant protein has a similar structure to the native clpX protein found in Flavobacterium columnare, with a conserved N-terminal domain and a highly conserved ATPase domain. The ATPase domain is responsible for the protein’s activity, while the N-terminal domain is involved in protein-protein interactions.

Activity of Recombinant Flavobacterium columnare clpX

The main function of clpX in Flavobacterium columnare is to regulate protein degradation and maintain protein quality control. This function is also conserved in the recombinant protein, making it a valuable tool in various research fields. Recombinant Flavobacterium columnare clpX has been shown to have ATPase activity, which is essential for its role in protein degradation. It also has chaperone activity, which helps in the folding and assembly of other proteins.

Application of Recombinant Flavobacterium columnare clpX

Due to its unique structure and activity, recombinant Flavobacterium columnare clpX has a wide range of potential applications in biotechnology and medicine. Some of the most promising applications include:

1. Production of recombinant proteins

Recombinant Flavobacterium columnare clpX has been used as a fusion partner in the production of recombinant proteins. By fusing the clpX gene with the gene of interest, researchers can improve the expression and solubility of the recombinant protein. This has been particularly useful in the production of difficult-to-express proteins.

2. Vaccine development

The N-terminal domain of recombinant Flavobacterium columnare clpX has been identified as a potential antigen for vaccine development against columnaris disease in fish. This domain has been shown to induce a strong immune response and provide protection against the disease. Further research is being conducted to optimize the use of this antigen in vaccine formulations.

3. Diagnostic tool

Recombinant Flavobacterium columnare clpX has also been used as a diagnostic tool for the detection of columnaris disease in fish. The recombinant protein can be used in serological tests to detect the presence of antibodies against Flavobacterium columnare, providing a rapid and accurate diagnosis of the disease.

4. Drug target

The ATPase domain of recombinant Flavobacterium columnare clpX has been identified as a potential drug target for the treatment of columnaris disease. By inhibiting the ATPase activity of the protein, it is possible to disrupt the protein degradation process in Flavobacterium columnare, leading to the death of the bacterium.

5. Research tool

Recombinant Flavobacterium columnare clpX has also been used as a research tool to study protein degradation and quality control mechanisms in bacteria. Its activity and structure make it an ideal model for understanding the function of clpX in other bacterial species.

Conclusion

In conclusion, recombinant Flavobacterium columnare clpX is a highly valuable protein with a unique

Recombinant Flavobacterium columnare clpX, N-His

There are no reviews yet.

Be the first to review “Recombinant Flavobacterium columnare clpX, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products