Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human ACVRL1/ALK-1 Protein, C-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
P37023
Molecular weight:
11.81 kDa

Original price was: $320.00.Current price is: $274.00.

50ug 14% OFF + 274 loyalty points
Asp22–Gln118
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human ACVRL1/ALK-1 Protein, C-His

Product name ARO-P10854-100
Uniprot ID P37023
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence DPVKPSRGPLVTCTCESPHCKGPTCRGAWCTVVLVREEGRHPQEHRGCGNLHRELCRGRPTEFVNHYCCDSHLCNHNVSLVLEATQPPSEQPGTD
Molecular weight 11.81 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Asp22-Gln118
Aliases /Synonyms Serine/threonine-protein kinase receptor R3, SKR3, 2.7.11.30, Activin receptor-like kinase 1, ALK-1, TGF-B superfamily receptor type I, TSR-I, ACVRL1, ACVRLK1, ALK1
Reference ARO-P10854
Note For research use only.
Molecular Constructor
Asp22–Gln118
Product name ARO-P10854-1MG
Uniprot ID P37023
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence DPVKPSRGPLVTCTCESPHCKGPTCRGAWCTVVLVREEGRHPQEHRGCGNLHRELCRGRPTEFVNHYCCDSHLCNHNVSLVLEATQPPSEQPGTD
Molecular weight 11.81 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Asp22-Gln118
Aliases /Synonyms Serine/threonine-protein kinase receptor R3, SKR3, 2.7.11.30, Activin receptor-like kinase 1, ALK-1, TGF-B superfamily receptor type I, TSR-I, ACVRL1, ACVRLK1, ALK1
Reference ARO-P10854
Note For research use only.
Molecular Constructor
Asp22–Gln118
Product name ARO-P10854-50
Uniprot ID P37023
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence DPVKPSRGPLVTCTCESPHCKGPTCRGAWCTVVLVREEGRHPQEHRGCGNLHRELCRGRPTEFVNHYCCDSHLCNHNVSLVLEATQPPSEQPGTD
Molecular weight 11.81 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Asp22-Gln118
Aliases /Synonyms Serine/threonine-protein kinase receptor R3, SKR3, 2.7.11.30, Activin receptor-like kinase 1, ALK-1, TGF-B superfamily receptor type I, TSR-I, ACVRL1, ACVRLK1, ALK1
Reference ARO-P10854
Note For research use only.
Molecular Constructor
Asp22–Gln118

Introduction

Recombinant Human ACVRL1/ALK-1 Protein, also known as Activin Receptor-Like Kinase 1, is a type I receptor for the transforming growth factor-beta (TGF-β) superfamily of proteins. It is encoded by the ACVRL1 gene and is a member of the bone morphogenetic protein (BMP) signaling pathway. This protein plays a crucial role in regulating cellular differentiation and growth, and it has been implicated in various diseases such as hereditary hemorrhagic telangiectasia (HHT) and pulmonary arterial hypertension (PAH).

Structure

The ACVRL1 protein is a transmembrane receptor with a molecular weight of approximately 60 kDa. It consists of a large extracellular domain, a single transmembrane domain, and a cytoplasmic serine/threonine kinase domain. The extracellular domain contains a highly conserved cysteine-rich region, which is responsible for ligand binding, and a glycine-serine-rich domain, which is important for receptor dimerization. The intracellular kinase domain is responsible for downstream signaling and is activated upon ligand binding.

Activity

The main function of ACVRL1 is to transduce signals from TGF-β superfamily ligands, such as BMPs, activins, and growth and differentiation factors (GDFs), to the nucleus. Upon ligand binding, the receptor dimerizes and activates the intracellular kinase domain, which then phosphorylates downstream signaling molecules, such as Smad proteins. These activated Smad proteins then translocate to the nucleus and regulate the expression of target genes involved in cell proliferation, differentiation, and apoptosis.

In addition to its role in TGF-β signaling, ACVRL1 is also involved in the regulation of angiogenesis, the process of forming new blood vessels from pre-existing ones. It has been shown to play a critical role in the development of blood vessels during embryogenesis, as well as in the maintenance of vascular homeostasis in adults. Dysregulation of ACVRL1 activity has been linked to diseases such as HHT and PAH, which are characterized by abnormal blood vessel formation and function.

Application

Recombinant Human ACVRL1/ALK-1 Protein has a wide range of applications in both research and clinical settings. One of the main applications is in the study of TGF-β signaling and its role in various cellular processes. Researchers can use the recombinant protein to investigate the mechanisms of ACVRL1 activation and downstream signaling, as well as its interactions with other signaling pathways.

In addition, the recombinant protein can be used as an antigen for the development of antibodies and other tools for the detection and quantification of ACVRL1 in biological samples. These tools are essential for understanding the role of ACVRL1 in disease progression and for the diagnosis and monitoring of diseases such as HHT and PAH.

Furthermore, the therapeutic potential of ACVRL1 has been explored in various preclinical and clinical studies. Recombinant Human ACVRL1/ALK-1 Protein can be used in the development of novel therapies for diseases associated with dysregulated TGF-β signaling, such as cancer, fibrosis, and cardiovascular diseases. It can also be used in the development of gene and cell therapies for HHT and PAH, as well as in the production of recombinant ACVRL1-based vaccines for these diseases.

Conclusion

In summary, Recombinant Human ACVRL1/ALK-1 Protein is a crucial component of the TGF-β signaling pathway and plays a critical role in regulating cellular processes such as differentiation, growth, and angiogenesis. Its structure, activity, and applications have been extensively studied, and it has shown great potential as a therapeutic target for various diseases. Further research and development of this protein will continue to expand our understanding of its role in health and disease and pave the way for new therapeutic interventions.

Recombinant Human ACVRL1/ALK-1 Protein, C-His

There are no reviews yet.

Be the first to review “Recombinant Human ACVRL1/ALK-1 Protein, C-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products