Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human CELF2 Protein, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
O95319
Molecular weight:
21.56 kDa

Original price was: $350.00.Current price is: $274.00.

50ug 22% OFF + 274 loyalty points
Lys41–Asp211
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human CELF2 Protein, N-His

Product name ARO-P12070-100
Uniprot ID O95319
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence KMFVGQIPRSWSEKELKELFEPYGAVYQINVLRDRSQNPPQSKGCCFVTFYTRKAALEAQNALHNIKTLPGMHHPIQMKPADSEKSNAVEDRKLFIGMVSKKCNENDIRVMFSPFGQIEECRILRGPDGLSRGCAFVTFSTRAMAQNAIKAMHQSQTMEGCSSPIVVKFAD
Molecular weight 21.56 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Lys41-Asp211
Aliases /Synonyms CELF-2, hNAPOR, Neuroblastoma apoptosis-related RNA-binding protein, CUGBP Elav-like family member 2, CUG-BP- and ETR-3-like factor 2, BRUNOL3, NAPOR, ETR3, CUGBP2, CUG triplet repeat RNA-binding protein 2, ETR-3, CELF2, ELAV-type RNA-binding protein 3, RNA-binding protein BRUNOL-3, Bruno-like protein 3, CUG-BP2
Reference ARO-P12070
Note For research use only.
Molecular Constructor
Lys41–Asp211
Product name ARO-P12070-1MG
Uniprot ID O95319
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence KMFVGQIPRSWSEKELKELFEPYGAVYQINVLRDRSQNPPQSKGCCFVTFYTRKAALEAQNALHNIKTLPGMHHPIQMKPADSEKSNAVEDRKLFIGMVSKKCNENDIRVMFSPFGQIEECRILRGPDGLSRGCAFVTFSTRAMAQNAIKAMHQSQTMEGCSSPIVVKFAD
Molecular weight 21.56 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Lys41-Asp211
Aliases /Synonyms CELF-2, hNAPOR, Neuroblastoma apoptosis-related RNA-binding protein, CUGBP Elav-like family member 2, CUG-BP- and ETR-3-like factor 2, BRUNOL3, NAPOR, ETR3, CUGBP2, CUG triplet repeat RNA-binding protein 2, ETR-3, CELF2, ELAV-type RNA-binding protein 3, RNA-binding protein BRUNOL-3, Bruno-like protein 3, CUG-BP2
Reference ARO-P12070
Note For research use only.
Molecular Constructor
Lys41–Asp211
Product name ARO-P12070-50
Uniprot ID O95319
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence KMFVGQIPRSWSEKELKELFEPYGAVYQINVLRDRSQNPPQSKGCCFVTFYTRKAALEAQNALHNIKTLPGMHHPIQMKPADSEKSNAVEDRKLFIGMVSKKCNENDIRVMFSPFGQIEECRILRGPDGLSRGCAFVTFSTRAMAQNAIKAMHQSQTMEGCSSPIVVKFAD
Molecular weight 21.56 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Lys41-Asp211
Aliases /Synonyms CELF-2, hNAPOR, Neuroblastoma apoptosis-related RNA-binding protein, CUGBP Elav-like family member 2, CUG-BP- and ETR-3-like factor 2, BRUNOL3, NAPOR, ETR3, CUGBP2, CUG triplet repeat RNA-binding protein 2, ETR-3, CELF2, ELAV-type RNA-binding protein 3, RNA-binding protein BRUNOL-3, Bruno-like protein 3, CUG-BP2
Reference ARO-P12070
Note For research use only.
Molecular Constructor
Lys41–Asp211

Introduction

Recombinant Human CELF2 Protein, also known as CUGBP Elav-like family member 2, is a protein that plays a crucial role in post-transcriptional regulation of gene expression. This protein is encoded by the CELF2 gene and is a member of the CELF/Bruno-like family of RNA-binding proteins. Recombinant Human CELF2 Protein is widely used in various research fields due to its diverse functions and potential therapeutic applications.

Structure of Recombinant Human CELF2 Protein

Recombinant Human CELF2 Protein is a 62 kDa protein with 534 amino acids. It contains three RNA recognition motifs (RRMs) and a nuclear localization sequence (NLS) at the N-terminus. The RRM domains enable the protein to bind to specific RNA sequences, while the NLS allows for its transport into the nucleus.

Activity of Recombinant Human CELF2 Protein

The main function of Recombinant Human CELF2 Protein is to regulate post-transcriptional gene expression. It does so by binding to specific RNA sequences and influencing their stability, splicing, and translation. This protein has been shown to interact with a wide range of RNA targets, including mRNAs, microRNAs, and long non-coding RNAs, and can modulate their expression levels.

Recombinant Human CELF2 Protein also plays a role in cell proliferation, differentiation, and apoptosis. It has been found to be involved in the regulation of immune response, muscle development, and neuronal activity. Furthermore, this protein has been linked to various diseases, such as cancer, cardiovascular disorders, and neurological disorders, highlighting its importance in maintaining cellular homeostasis.

Application of Recombinant Human CELF2 Protein

Due to its diverse functions, Recombinant Human CELF2 Protein has a wide range of applications in research and potential therapeutic uses. One of the main applications of this protein is in the study of post-transcriptional gene regulation. Its ability to bind to specific RNA sequences and regulate their expression makes it a valuable tool in understanding the mechanisms of gene expression and its dysregulation in various diseases.

Moreover, Recombinant Human CELF2 Protein has been used in the development of diagnostic and prognostic markers for diseases such as cancer. Its altered expression levels have been linked to various types of cancer, making it a potential biomarker for early detection and monitoring of the disease.

Another potential application of Recombinant Human CELF2 Protein is in the development of therapeutics. Its involvement in various diseases and its ability to regulate gene expression make it a potential target for drug development. By targeting this protein, it may be possible to modulate the expression of specific genes and treat diseases at the molecular level.

Conclusion

In conclusion, Recombinant Human CELF2 Protein is a crucial protein involved in post-transcriptional gene regulation and plays a role in various cellular processes. Its structure, activity, and potential applications make it a valuable tool in research and a potential target for therapeutics. Further studies on this protein may lead to a better understanding of its functions and potential uses in the prevention and treatment of diseases.

Recombinant Human CELF2 Protein, N-His

There are no reviews yet.

Be the first to review “Recombinant Human CELF2 Protein, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products