Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human CPEB1, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
Q9BZB8
Molecular weight:
30.80 kDa

Original price was: $409.00.Current price is: $327.00.

100ug 20% OFF + 327 loyalty points
Cys311–Lys561
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human CPEB1, N-His

Product name ARO-P13125-100
Uniprot ID Q9BZB8
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence CKVFLGGVPWDITEAGLVNTFRVFGSLSVEWPGKDGKHPRCPPKGNMPKGYVYLVFELEKSVRSLLQACSHDPLSPDGLSEYYFKMSSRRMRCKEVQVIPWVLADSNFVRSPSQRLDPSRTVFVGALHGMLNAEALAAILNDLFGGVVYAGIDTDKHKYPIGSGRVTFNNQRSYLKAVSAAFVEIKTTKFTKKVQIDPYLEDSLCHICSSQPGPFFCRDQVCFKYFCRSCWHWRHSMEGLRHHSPLMRNQK
Molecular weight 30.80 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Cys311-Lys561
Aliases /Synonyms CPEB, hCPEB-1, Cytoplasmic polyadenylation element-binding protein 1, CPE-binding protein 1, CPEB1, h-CPEB, CPE-BP1
Reference ARO-P13125
Note For research use only.
Molecular Constructor
Cys311–Lys561
Product name ARO-P13125-1MG
Uniprot ID Q9BZB8
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence CKVFLGGVPWDITEAGLVNTFRVFGSLSVEWPGKDGKHPRCPPKGNMPKGYVYLVFELEKSVRSLLQACSHDPLSPDGLSEYYFKMSSRRMRCKEVQVIPWVLADSNFVRSPSQRLDPSRTVFVGALHGMLNAEALAAILNDLFGGVVYAGIDTDKHKYPIGSGRVTFNNQRSYLKAVSAAFVEIKTTKFTKKVQIDPYLEDSLCHICSSQPGPFFCRDQVCFKYFCRSCWHWRHSMEGLRHHSPLMRNQK
Molecular weight 30.80 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Cys311-Lys561
Aliases /Synonyms CPEB, hCPEB-1, Cytoplasmic polyadenylation element-binding protein 1, CPE-binding protein 1, CPEB1, h-CPEB, CPE-BP1
Reference ARO-P13125
Note For research use only.
Molecular Constructor
Cys311–Lys561
Product name ARO-P13125-50
Uniprot ID Q9BZB8
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence CKVFLGGVPWDITEAGLVNTFRVFGSLSVEWPGKDGKHPRCPPKGNMPKGYVYLVFELEKSVRSLLQACSHDPLSPDGLSEYYFKMSSRRMRCKEVQVIPWVLADSNFVRSPSQRLDPSRTVFVGALHGMLNAEALAAILNDLFGGVVYAGIDTDKHKYPIGSGRVTFNNQRSYLKAVSAAFVEIKTTKFTKKVQIDPYLEDSLCHICSSQPGPFFCRDQVCFKYFCRSCWHWRHSMEGLRHHSPLMRNQK
Molecular weight 30.80 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Cys311-Lys561
Aliases /Synonyms CPEB, hCPEB-1, Cytoplasmic polyadenylation element-binding protein 1, CPE-binding protein 1, CPEB1, h-CPEB, CPE-BP1
Reference ARO-P13125
Note For research use only.
Molecular Constructor
Cys311–Lys561

Introduction to Recombinant Human CPEB1

Recombinant human CPEB1 (Cytoplasmic Polyadenylation Element Binding protein 1) is a protein that plays a crucial role in regulating gene expression in eukaryotic cells. It is a member of the CPEB family of proteins and is encoded by the CPEB1 gene located on chromosome 15 in humans. CPEB1 is primarily found in the cytoplasm and is involved in the process of cytoplasmic polyadenylation, which is essential for the translation of specific mRNAs. In this article, we will discuss the structure, activity, and applications of recombinant human CPEB1.

Structure of Recombinant Human CPEB1

Recombinant human CPEB1 is a 62 kDa protein consisting of 567 amino acids. It contains three main domains: an N-terminal RNA-binding domain, a central prion-like domain, and a C-terminal regulatory domain. The RNA-binding domain is responsible for binding to specific RNA sequences, while the prion-like domain is essential for the aggregation of CPEB1 into functional units. The regulatory domain contains multiple phosphorylation sites that regulate the activity of CPEB1.

Activity of Recombinant Human CPEB1

The primary function of recombinant human CPEB1 is to regulate the translation of specific mRNAs in the cytoplasm. It does so by binding to the cytoplasmic polyadenylation element (CPE) sequence located in the 3′ untranslated region (UTR) of target mRNAs. This binding promotes the elongation of the poly(A) tail, which is essential for the initiation of translation. CPEB1 also interacts with other proteins and factors involved in the translation process, such as eIF4E and PABP, to regulate translation efficiency.

Apart from its role in cytoplasmic polyadenylation, CPEB1 has also been implicated in other cellular processes. It has been shown to play a role in cell division, cell differentiation, and synaptic plasticity. Additionally, CPEB1 has been linked to various diseases, including cancer, neurodegenerative disorders, and viral infections, highlighting its importance in cellular homeostasis.

Applications of Recombinant Human CPEB1

Recombinant human CPEB1 has been widely used in research to study its role in regulating gene expression and its involvement in various cellular processes. It has also been used to investigate the potential therapeutic applications of targeting CPEB1 in diseases such as cancer and neurodegenerative disorders.

One of the major applications of recombinant human CPEB1 is in the development of diagnostic tools. CPEB1 has been identified as a potential biomarker for various cancers, including breast, prostate, and colon cancer. The detection of CPEB1 levels in patient samples can aid in the early diagnosis and monitoring of these cancers.

Moreover, recombinant human CPEB1 has also been utilized in drug discovery and development. As CPEB1 is involved in several diseases, targeting it with specific inhibitors or activators can provide potential therapeutic options. For instance, inhibiting CPEB1 activity has shown promising results in reducing tumor growth in breast cancer models.

In addition to its research and diagnostic applications, recombinant human CPEB1 has also been used in the biotechnology industry. It is produced using recombinant DNA technology, making it a valuable tool for studying the structure and function of CPEB1. It can also be used in the production of recombinant proteins and antigens for various applications, including drug development and vaccine production.

Conclusion

In summary, recombinant human CPEB1 is a crucial protein involved in regulating gene expression and various cellular processes. Its structure, activity, and applications have been extensively studied, highlighting its significance in cellular homeostasis and disease. With ongoing research and advancements in technology,

Recombinant Human CPEB1, N-His

There are no reviews yet.

Be the first to review “Recombinant Human CPEB1, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products