Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human GALE Protein, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
Q14376
Molecular weight:
40.44 kDa

Original price was: $471.00.Current price is: $380.00.

100ug 19% OFF + 380 loyalty points
Met1–Ala348
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human GALE Protein, N-His

Product name ARO-P12181-100
Uniprot ID Q14376
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence MAEKVLVTGGAGYIGSHTVLELLEAGYLPVVIDNFHNAFRGGGSLPESLRRVQELTGRSVEFEEMDILDQGALQRLFKKYSFMAVIHFAGLKAVGESVQKPLDYYRVNLTGTIQLLEIMKAHGVKNLVFSSSATVYGNPQYLPLDEAHPTGGCTNPYGKSKFFIEEMIRDLCQADKTWNAVLLRYFNPTGAHASGCIGEDPQGIPNNLMPYVSQVAIGRREALNVFGNDYDTEDGTGVRDYIHVVDLAKGHIAALRKLKEQCGCRIYNLGTGTGYSVLQMVQAMEKASGKKIPYKVVARREGDVAACYANPSLAQEELGWTAALGLDRMCEDLWRWQKQNPSGFGTQA
Molecular weight 40.44 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met1-Ala348
Aliases /Synonyms UDP-galactose 4-epimerase, UDP-N-acetylgalactosamine 4-epimerase, Galactowaldenase, UDP-glucose 4-epimerase, GALE, UDP-GalNAc 4-epimerase, UDP-N-acetylglucosamine 4-epimerase, UDP-GlcNAc 4-epimerase
Reference ARO-P12181
Note For research use only.
Molecular Constructor
Met1–Ala348
Product name ARO-P12181-1MG
Uniprot ID Q14376
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence MAEKVLVTGGAGYIGSHTVLELLEAGYLPVVIDNFHNAFRGGGSLPESLRRVQELTGRSVEFEEMDILDQGALQRLFKKYSFMAVIHFAGLKAVGESVQKPLDYYRVNLTGTIQLLEIMKAHGVKNLVFSSSATVYGNPQYLPLDEAHPTGGCTNPYGKSKFFIEEMIRDLCQADKTWNAVLLRYFNPTGAHASGCIGEDPQGIPNNLMPYVSQVAIGRREALNVFGNDYDTEDGTGVRDYIHVVDLAKGHIAALRKLKEQCGCRIYNLGTGTGYSVLQMVQAMEKASGKKIPYKVVARREGDVAACYANPSLAQEELGWTAALGLDRMCEDLWRWQKQNPSGFGTQA
Molecular weight 40.44 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met1-Ala348
Aliases /Synonyms UDP-galactose 4-epimerase, UDP-N-acetylgalactosamine 4-epimerase, Galactowaldenase, UDP-glucose 4-epimerase, GALE, UDP-GalNAc 4-epimerase, UDP-N-acetylglucosamine 4-epimerase, UDP-GlcNAc 4-epimerase
Reference ARO-P12181
Note For research use only.
Molecular Constructor
Met1–Ala348
Product name ARO-P12181-50
Uniprot ID Q14376
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence MAEKVLVTGGAGYIGSHTVLELLEAGYLPVVIDNFHNAFRGGGSLPESLRRVQELTGRSVEFEEMDILDQGALQRLFKKYSFMAVIHFAGLKAVGESVQKPLDYYRVNLTGTIQLLEIMKAHGVKNLVFSSSATVYGNPQYLPLDEAHPTGGCTNPYGKSKFFIEEMIRDLCQADKTWNAVLLRYFNPTGAHASGCIGEDPQGIPNNLMPYVSQVAIGRREALNVFGNDYDTEDGTGVRDYIHVVDLAKGHIAALRKLKEQCGCRIYNLGTGTGYSVLQMVQAMEKASGKKIPYKVVARREGDVAACYANPSLAQEELGWTAALGLDRMCEDLWRWQKQNPSGFGTQA
Molecular weight 40.44 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met1-Ala348
Aliases /Synonyms UDP-galactose 4-epimerase, UDP-N-acetylgalactosamine 4-epimerase, Galactowaldenase, UDP-glucose 4-epimerase, GALE, UDP-GalNAc 4-epimerase, UDP-N-acetylglucosamine 4-epimerase, UDP-GlcNAc 4-epimerase
Reference ARO-P12181
Note For research use only.
Molecular Constructor
Met1–Ala348

Introduction

Recombinant Human GALE Protein, also known as UDP-galactose 4-epimerase, is a key enzyme involved in the biosynthesis of galactose, an important sugar molecule that plays a crucial role in various biological processes. This protein is produced through genetic engineering techniques, making it a recombinant protein with high purity and specific activity. In this article, we will provide a detailed description of the structure, activity, and applications of Recombinant Human GALE Protein.

Structure of Recombinant Human GALE Protein

Recombinant Human GALE Protein is a homodimer, meaning it is composed of two identical subunits. Each subunit has a molecular weight of approximately 37 kDa and consists of 338 amino acids. The primary structure of this protein is highly conserved among different species, with over 90% sequence identity between human and mouse GALE proteins.

The three-dimensional structure of Recombinant Human GALE Protein has been determined through X-ray crystallography, revealing a compact and globular shape. The protein is composed of two domains, an N-terminal domain and a C-terminal domain, connected by a flexible linker region. The active site of the enzyme is located at the interface between the two domains, where the catalytic reaction takes place.

Activity of Recombinant Human GALE Protein

Recombinant Human GALE Protein is a crucial enzyme in the Leloir pathway, which is responsible for the conversion of glucose to galactose. This pathway is essential for the production of galactose, which is required for the synthesis of glycoproteins, glycolipids, and other important molecules. The catalytic activity of Recombinant Human GALE Protein is to convert UDP-glucose to UDP-galactose, which is the first step in the Leloir pathway.

The enzymatic activity of Recombinant Human GALE Protein is highly specific and efficient, with a turnover rate of approximately 100 molecules per second. This high activity is due to the precise positioning of key amino acids in the active site, which allows for optimal binding and catalysis of the substrate. Additionally, the recombinant nature of this protein ensures a high level of purity and specific activity, making it a valuable tool for research and industrial applications.

Applications of Recombinant Human GALE Protein

Recombinant Human GALE Protein has a wide range of applications in both research and industrial settings. One of the primary uses of this protein is in the production of galactose for various biochemical and biotechnological processes. The catalytic activity of Recombinant Human GALE Protein can be harnessed to produce large quantities of UDP-galactose, which is used as a substrate for the synthesis of various galactose-containing molecules.

In addition to its role in galactose biosynthesis, Recombinant Human GALE Protein has been extensively studied for its potential therapeutic applications. Mutations in the GALE gene have been linked to a rare metabolic disorder called epimerase deficiency galactosemia, which results in the accumulation of toxic metabolites and can lead to severe health complications. Recombinant Human GALE Protein has been used in studies to understand the underlying mechanisms of this disorder and to develop potential treatments.

Furthermore, Recombinant Human GALE Protein has been used in research to study the role of galactose in various biological processes, such as cell signaling, immune response, and development. Its high purity and specific activity make it an ideal tool for studying the effects of galactose on different cell types and tissues.

Conclusion

In summary, Recombinant Human GALE Protein is a key enzyme involved in the biosynthesis of galactose, with a highly specific and efficient catalytic activity. Its recombinant nature allows for a high level of purity and specific activity, making it a valuable tool for various research and industrial applications. The detailed understanding of its structure, activity, and applications has opened up new avenues for the development of potential

Recombinant Human GALE Protein, N-His

There are no reviews yet.

Be the first to review “Recombinant Human GALE Protein, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products