Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human GOLM1, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
Q8NBJ4
Molecular weight:
43.48 kDa

Original price was: $267.00.Current price is: $230.00.

50ug 14% OFF + 230 loyalty points
Val40–Leu401
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human GOLM1, N-His

Product name ARO-P13244-100
Uniprot ID Q8NBJ4
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence VDLQTRIMELEGRVRRAAAERGAVELKKNEFQGELEKQREQLDKIQSSHNFQLESVNKLYQDEKAVLVNNITTGERLIRVLQDQLKTLQRNYGRLQQDVLQFQKNQTNLERKFSYDLSQCINQMKEVKEQCEERIEEVTKKGNEAVASRDLSENNDQRQQLQALSEPQPRLQAAGLPHTEVPQGKGNVLGNSKSQTPAPSSEVVLDSKRQVEKEETNEIQVVNEEPQRDRLPQEPGREQVVEDRPVGGRGFGGAGELGQTPQVQAALSVSQENPEMEGPERDQLVIPDGQEEEQEAAGEGRNQQKLRGEDDYNMDENEAESETDKQAALAGNDRNIDVFNVEDQKRDTINLLDQREKRNHTL
Molecular weight 43.48 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Val40-Leu401
Aliases /Synonyms Golgi phosphoprotein 2, C9orf155, Golgi membrane protein GP73, Golgi membrane protein 1, GOLPH2, GOLM1
Reference ARO-P13244
Note For research use only.
Molecular Constructor
Val40–Leu401
Product name ARO-P13244-1MG
Uniprot ID Q8NBJ4
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence VDLQTRIMELEGRVRRAAAERGAVELKKNEFQGELEKQREQLDKIQSSHNFQLESVNKLYQDEKAVLVNNITTGERLIRVLQDQLKTLQRNYGRLQQDVLQFQKNQTNLERKFSYDLSQCINQMKEVKEQCEERIEEVTKKGNEAVASRDLSENNDQRQQLQALSEPQPRLQAAGLPHTEVPQGKGNVLGNSKSQTPAPSSEVVLDSKRQVEKEETNEIQVVNEEPQRDRLPQEPGREQVVEDRPVGGRGFGGAGELGQTPQVQAALSVSQENPEMEGPERDQLVIPDGQEEEQEAAGEGRNQQKLRGEDDYNMDENEAESETDKQAALAGNDRNIDVFNVEDQKRDTINLLDQREKRNHTL
Molecular weight 43.48 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Val40-Leu401
Aliases /Synonyms Golgi phosphoprotein 2, C9orf155, Golgi membrane protein GP73, Golgi membrane protein 1, GOLPH2, GOLM1
Reference ARO-P13244
Note For research use only.
Molecular Constructor
Val40–Leu401
Product name ARO-P13244-50
Uniprot ID Q8NBJ4
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence VDLQTRIMELEGRVRRAAAERGAVELKKNEFQGELEKQREQLDKIQSSHNFQLESVNKLYQDEKAVLVNNITTGERLIRVLQDQLKTLQRNYGRLQQDVLQFQKNQTNLERKFSYDLSQCINQMKEVKEQCEERIEEVTKKGNEAVASRDLSENNDQRQQLQALSEPQPRLQAAGLPHTEVPQGKGNVLGNSKSQTPAPSSEVVLDSKRQVEKEETNEIQVVNEEPQRDRLPQEPGREQVVEDRPVGGRGFGGAGELGQTPQVQAALSVSQENPEMEGPERDQLVIPDGQEEEQEAAGEGRNQQKLRGEDDYNMDENEAESETDKQAALAGNDRNIDVFNVEDQKRDTINLLDQREKRNHTL
Molecular weight 43.48 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Val40-Leu401
Aliases /Synonyms Golgi phosphoprotein 2, C9orf155, Golgi membrane protein GP73, Golgi membrane protein 1, GOLPH2, GOLM1
Reference ARO-P13244
Note For research use only.
Molecular Constructor
Val40–Leu401

Title: Introduction to Recombinant Human GOLM1

Recombinant Human GOLM1, also known as Golgi membrane protein 1, is a protein that plays a crucial role in the structure and function of the Golgi apparatus. This protein is encoded by the GOLM1 gene and is highly conserved across different species, indicating its importance in cellular processes.

Structure of Recombinant Human GOLM1

The recombinant form of human GOLM1 is a 65 kDa protein that consists of 591 amino acids. It contains a transmembrane domain, a cytoplasmic tail, and a luminal domain. The luminal domain is further divided into two subdomains, the N-terminal and C-terminal domains, which are connected by a flexible linker region.

The N-terminal domain of GOLM1 is responsible for its interaction with other proteins and plays a role in protein trafficking within the Golgi apparatus. The C-terminal domain contains a glycosylation site, which is important for the proper folding and stability of the protein.

Activity of Recombinant Human GOLM1

Recombinant Human GOLM1 is primarily involved in the maintenance of the Golgi apparatus structure and function. It is a type II transmembrane protein, which means that it is anchored to the Golgi membrane with its N-terminus facing the cytoplasm.

One of the key functions of GOLM1 is its role in protein trafficking within the Golgi apparatus. It interacts with other proteins, such as the Golgi-specific protein GOLPH3, to regulate the transport of proteins between different compartments of the Golgi. This is essential for the proper functioning of the Golgi apparatus, which is responsible for processing and sorting of proteins for secretion or use within the cell.

In addition to its role in protein trafficking, GOLM1 also plays a role in maintaining the structural integrity of the Golgi apparatus. It has been shown to be involved in the formation of Golgi stacks, which are essential for the proper functioning of the Golgi. GOLM1 also plays a role in the maintenance of Golgi morphology, as it interacts with other Golgi-associated proteins to regulate the shape and size of the Golgi apparatus.

Application of Recombinant Human GOLM1

Recombinant Human GOLM1 has a wide range of applications in both research and clinical settings. Its role in protein trafficking and maintenance of Golgi structure makes it a valuable tool for studying cellular processes and diseases.

In research, recombinant GOLM1 can be used to study the mechanisms of protein trafficking and Golgi function. It can also be used to investigate the role of GOLM1 in diseases such as cancer, where abnormal protein trafficking and Golgi dysfunction have been observed.

In clinical settings, recombinant GOLM1 can be used as an antigen for diagnostic tests. GOLM1 has been found to be overexpressed in various types of cancer, making it a potential biomarker for early detection and monitoring of cancer progression.

Conclusion

Recombinant Human GOLM1 is a crucial protein involved in maintaining the structure and function of the Golgi apparatus. Its role in protein trafficking and Golgi morphology makes it an important protein in cellular processes and diseases. With its wide range of applications in research and clinical settings, recombinant GOLM1 continues to be a valuable tool in understanding and diagnosing various diseases.

Recombinant Human GOLM1, N-His

There are no reviews yet.

Be the first to review “Recombinant Human GOLM1, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products