Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human MARCO Protein, N-His-SUMO

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
Q9UEW3
Molecular weight:
23.37 kDa

Original price was: $280.00.Current price is: $230.00.

50ug 18% OFF + 230 loyalty points
Ser421–Val520
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human MARCO Protein, N-His-SUMO

Product name ARO-P11567-100
Uniprot ID Q9UEW3
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence SVSVRIVGSSNRGRAEVYYSGTWGTICDDEWQNSDAIVFCRMLGYSKGRALYKVGAGTGQIWLDNVQCRGTESTLWSCTKNSWGHHDCSHEEDAGVECSV
Molecular weight 23.37 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ser421-Val520
Aliases /Synonyms SCARA2, Scavenger receptor class A member 2, MARCO, Macrophage receptor MARCO, Macrophage receptor with collagenous structure
Reference ARO-P11567
Note For research use only.
Molecular Constructor
Ser421–Val520
Product name ARO-P11567-1MG
Uniprot ID Q9UEW3
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence SVSVRIVGSSNRGRAEVYYSGTWGTICDDEWQNSDAIVFCRMLGYSKGRALYKVGAGTGQIWLDNVQCRGTESTLWSCTKNSWGHHDCSHEEDAGVECSV
Molecular weight 23.37 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ser421-Val520
Aliases /Synonyms SCARA2, Scavenger receptor class A member 2, MARCO, Macrophage receptor MARCO, Macrophage receptor with collagenous structure
Reference ARO-P11567
Note For research use only.
Molecular Constructor
Ser421–Val520
Product name ARO-P11567-50
Uniprot ID Q9UEW3
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence SVSVRIVGSSNRGRAEVYYSGTWGTICDDEWQNSDAIVFCRMLGYSKGRALYKVGAGTGQIWLDNVQCRGTESTLWSCTKNSWGHHDCSHEEDAGVECSV
Molecular weight 23.37 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ser421-Val520
Aliases /Synonyms SCARA2, Scavenger receptor class A member 2, MARCO, Macrophage receptor MARCO, Macrophage receptor with collagenous structure
Reference ARO-P11567
Note For research use only.
Molecular Constructor
Ser421–Val520

Introduction

Recombinant Human MARCO Protein is a type of recombinant protein that has been produced through genetic engineering techniques. This protein is a member of the scavenger receptor family and plays a crucial role in the immune system as an antigen-presenting receptor. In this article, we will discuss the structure, activity and application of Recombinant Human MARCO Protein in detail.

Structure of Recombinant Human MARCO Protein

The gene encoding for MARCO protein is located on chromosome 2 in humans and consists of 13 exons. The protein is composed of 520 amino acids with a predicted molecular weight of 60 kDa. The primary structure of MARCO protein contains a cysteine-rich extracellular domain, a transmembrane domain and a cytoplasmic tail. The extracellular domain is responsible for ligand binding, while the cytoplasmic tail is involved in signal transduction.

The crystal structure of Recombinant Human MARCO Protein has been determined, revealing a trimeric arrangement of the extracellular domain. Each monomer consists of a beta-propeller domain and a C-type lectin-like domain. The beta-propeller domain is responsible for ligand binding, while the C-type lectin-like domain is involved in oligomerization and signal transduction. The trimeric arrangement of MARCO protein allows for efficient binding of ligands and activation of downstream signaling pathways.

Activity of Recombinant Human MARCO Protein

As a scavenger receptor, MARCO protein plays a crucial role in the recognition and clearance of foreign particles, such as bacteria and viruses, from the body. It does so by binding to a wide range of ligands, including lipopolysaccharides, lipoteichoic acid, and bacterial and viral proteins. This binding triggers downstream signaling pathways, leading to the activation of immune cells and the production of pro-inflammatory cytokines.

In addition to its role in immune defense, MARCO protein has also been shown to play a role in wound healing and tissue repair. It has been found to regulate the migration and proliferation of fibroblasts, which are important cells in the wound healing process. This suggests that Recombinant Human MARCO Protein may have potential therapeutic applications in wound healing and tissue repair.

Application of Recombinant Human MARCO Protein

Recombinant Human MARCO Protein has a wide range of applications in both research and clinical settings. In research, it is commonly used as a tool to study the role of MARCO protein in immune function and disease. The availability of recombinant protein allows for the manipulation and study of specific domains or mutations of MARCO protein, providing valuable insights into its structure and function.

In clinical settings, Recombinant Human MARCO Protein has potential applications in the development of vaccines and immunotherapies. Its ability to bind to a wide range of ligands makes it an attractive candidate for vaccine development against bacterial and viral infections. Furthermore, its role in wound healing and tissue repair suggests that it may have potential therapeutic applications in regenerative medicine.

Conclusion

In summary, Recombinant Human MARCO Protein is a versatile protein with a complex structure and diverse functions. Its role in immune defense, wound healing, and tissue repair makes it a valuable tool for both research and clinical applications. With ongoing research and advancements in genetic engineering techniques, the potential of Recombinant Human MARCO Protein in various fields is continuously expanding.

Recombinant Human MARCO Protein, N-His-SUMO

There are no reviews yet.

Be the first to review “Recombinant Human MARCO Protein, N-His-SUMO”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products