Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human MFSD8/CLN7 Protein, N-GST & C-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
Q8NHS3
Molecular weight:
34.46 kDa

Original price was: $292.00.Current price is: $230.00.

50ug 21% OFF + 230 loyalty points
Asn359–Pro412
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human MFSD8/CLN7 Protein, N-GST & C-His

Product name ARO-P11511-100
Uniprot ID Q8NHS3
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence NQFPKIQWEDLHNNSIPNTTFGEIIIGLWKSPMEDDNERPTGCSIEQAWCLYTP
Molecular weight 34.46 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Asn359-Pro412
Aliases /Synonyms CLN7, MFSD8, Major facilitator superfamily domain-containing protein 8, Ceroid-lipofuscinosis neuronal protein 7
Reference ARO-P11511
Note For research use only.
Molecular Constructor
Asn359–Pro412
Product name ARO-P11511-1MG
Uniprot ID Q8NHS3
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence NQFPKIQWEDLHNNSIPNTTFGEIIIGLWKSPMEDDNERPTGCSIEQAWCLYTP
Molecular weight 34.46 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Asn359-Pro412
Aliases /Synonyms CLN7, MFSD8, Major facilitator superfamily domain-containing protein 8, Ceroid-lipofuscinosis neuronal protein 7
Reference ARO-P11511
Note For research use only.
Molecular Constructor
Asn359–Pro412
Product name ARO-P11511-50
Uniprot ID Q8NHS3
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence NQFPKIQWEDLHNNSIPNTTFGEIIIGLWKSPMEDDNERPTGCSIEQAWCLYTP
Molecular weight 34.46 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Asn359-Pro412
Aliases /Synonyms CLN7, MFSD8, Major facilitator superfamily domain-containing protein 8, Ceroid-lipofuscinosis neuronal protein 7
Reference ARO-P11511
Note For research use only.
Molecular Constructor
Asn359–Pro412

Introduction

Recombinant Human MFSD8/CLN7 Protein is a protein that has been produced through genetic engineering techniques in a laboratory setting. This protein is a member of the major facilitator superfamily (MFS) and is also known as CLN7, which stands for ceroid lipofuscinosis, neuronal 7. It plays a crucial role in the transport of various molecules across cell membranes and has been identified as a potential therapeutic target for neurodegenerative diseases.

Structure of Recombinant Human MFSD8/CLN7 Protein

Recombinant Human MFSD8/CLN7 Protein is a transmembrane protein that consists of 518 amino acids. It has a predicted molecular weight of approximately 57 kDa and contains 12 transmembrane domains. The protein has a conserved domain known as the major facilitator superfamily (MFS) domain, which is responsible for its transport activity. The structure of this protein has been studied using various techniques, including X-ray crystallography and nuclear magnetic resonance (NMR) spectroscopy.

Activity of Recombinant Human MFSD8/CLN7 Protein

Recombinant Human MFSD8/CLN7 Protein is primarily involved in the transport of small molecules, such as amino acids, nucleosides, and organic acids, across cell membranes. It acts as a secondary active transporter, utilizing the energy from the movement of other molecules to transport its substrates. This protein has been shown to have a broad substrate specificity, with a preference for neutral and cationic compounds. It has also been reported to play a role in the transport of lysosomal enzymes and proteins, suggesting its involvement in lysosomal function.

Application of Recombinant Human MFSD8/CLN7 Protein

The potential therapeutic applications of Recombinant Human MFSD8/CLN7 Protein are primarily focused on its role in neurodegenerative diseases. Mutations in the MFSD8 gene have been linked to the development of neuronal ceroid lipofuscinoses (NCLs), a group of inherited neurodegenerative disorders characterized by the accumulation of lipofuscin in neurons. These disorders have no cure and are currently managed symptomatically. However, the use of recombinant MFSD8 protein as a therapeutic agent has shown promising results in preclinical studies.

One potential application of recombinant MFSD8 protein is in the treatment of late-infantile NCL, also known as CLN7 disease. Studies have shown that the administration of recombinant MFSD8 protein can improve lysosomal function and reduce lipofuscin accumulation in cells derived from patients with CLN7 disease. This suggests that recombinant MFSD8 protein could potentially slow down or prevent disease progression in patients with CLN7 disease.

Recombinant MFSD8 protein has also been studied for its potential use in the treatment of other neurodegenerative diseases, such as Alzheimer’s and Parkinson’s disease. These diseases are characterized by the accumulation of toxic proteins in the brain, leading to neuronal death. As MFSD8 plays a role in lysosomal function, it has been proposed that recombinant MFSD8 protein could help in clearing these toxic proteins and prevent their accumulation, thus potentially slowing down disease progression.

In addition to its therapeutic applications, recombinant MFSD8 protein also has potential uses in research. It can be used as an antigen in the development of diagnostic tests for NCLs, allowing for early detection and treatment of these diseases. Furthermore, recombinant MFSD8 protein can also be used in structural and functional studies to gain a better understanding of its role in various cellular processes.

Conclusion

Recombinant Human MFSD8/CLN7 Protein is a transmembrane protein that plays a crucial role in the transport of molecules across cell membranes. Its potential therapeutic applications in neurodegenerative diseases, particularly CLN7 disease, make it an important protein for further research and development. With its

Recombinant Human MFSD8/CLN7 Protein, N-GST & C-His

There are no reviews yet.

Be the first to review “Recombinant Human MFSD8/CLN7 Protein, N-GST & C-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products