Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human NDUFB6 Protein, N-His-SUMO & C-Strep

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
O95139
Molecular weight:
21.86 kDa

Original price was: $376.00.Current price is: $327.00.

100ug 13% OFF + 327 loyalty points
Thr2–Ser68
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human NDUFB6 Protein, N-His-SUMO & C-Strep

Product name ARO-P11842-100
Uniprot ID O95139
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence TGYTPDEKLRLQQLRELRRRWLKDQELSPREPVLPPQKMGPMEKFWNKFLENKSPWRKMVHGVYKKS
Molecular weight 21.86 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Thr2-Ser68
Aliases /Synonyms NDUFB6, NADH-ubiquinone oxidoreductase B17 subunit, NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 6, Complex I-B17, CI-B17
Reference ARO-P11842
Note For research use only.
Molecular Constructor
Thr2–Ser68
Product name ARO-P11842-1MG
Uniprot ID O95139
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence TGYTPDEKLRLQQLRELRRRWLKDQELSPREPVLPPQKMGPMEKFWNKFLENKSPWRKMVHGVYKKS
Molecular weight 21.86 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Thr2-Ser68
Aliases /Synonyms NDUFB6, NADH-ubiquinone oxidoreductase B17 subunit, NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 6, Complex I-B17, CI-B17
Reference ARO-P11842
Note For research use only.
Molecular Constructor
Thr2–Ser68
Product name ARO-P11842-50
Uniprot ID O95139
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence TGYTPDEKLRLQQLRELRRRWLKDQELSPREPVLPPQKMGPMEKFWNKFLENKSPWRKMVHGVYKKS
Molecular weight 21.86 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Thr2-Ser68
Aliases /Synonyms NDUFB6, NADH-ubiquinone oxidoreductase B17 subunit, NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 6, Complex I-B17, CI-B17
Reference ARO-P11842
Note For research use only.
Molecular Constructor
Thr2–Ser68

Introduction

Recombinant proteins have become an essential tool in various fields of research, including biotechnology, medicine, and biochemistry. These proteins are produced by genetically engineering a specific gene into a host organism, typically a bacterial or mammalian cell, to produce large quantities of the desired protein. One such protein is Recombinant Human NDUFB6, which plays a crucial role in the structure and function of the respiratory chain complex I. In this article, we will explore the structure, activity, and application of Recombinant Human NDUFB6 Protein.

Structure of Recombinant Human NDUFB6 Protein

Recombinant Human NDUFB6 Protein is a subunit of the NADH:ubiquinone oxidoreductase, also known as complex I, which is the first enzyme in the mitochondrial respiratory chain. The gene encoding NDUFB6 is located on chromosome 9 and consists of 6 exons that span over 10 kb. The protein has a molecular weight of approximately 18 kDa and is composed of 161 amino acids. The primary structure of NDUFB6 contains a conserved N-terminal domain, a transmembrane domain, and a C-terminal domain. The N-terminal domain is essential for the stability and assembly of complex I, while the transmembrane domain plays a role in the interaction with other subunits of the complex. The C-terminal domain is responsible for the binding of NADH and the transfer of electrons to the respiratory chain.

Activity of Recombinant Human NDUFB6 Protein

Recombinant Human NDUFB6 Protein is a critical component of the respiratory chain complex I, which is responsible for the transfer of electrons from NADH to ubiquinone, generating a proton gradient across the mitochondrial inner membrane. This gradient is then used to produce ATP, the energy currency of the cell. NDUFB6 is involved in the initial steps of electron transfer, where it accepts electrons from NADH and transfers them to the next subunit of the complex. This process is crucial for the proper functioning of the respiratory chain and the production of energy in the form of ATP.

Application of Recombinant Human NDUFB6 Protein

Recombinant Human NDUFB6 Protein has various applications in both research and medicine. In research, it is used in the study of mitochondrial function and dysfunction, particularly in the context of complex I deficiency, which is associated with various human diseases. Recombinant NDUFB6 has also been used in the production of monoclonal antibodies for the detection of complex I subunits in various tissues and cell types. In medicine, NDUFB6 has been identified as a potential therapeutic target for the treatment of complex I-related diseases, such as Parkinson’s disease and Leber’s hereditary optic neuropathy. Additionally, recombinant NDUFB6 has been used in the development of diagnostic tests for the detection of complex I deficiencies in patients.

Conclusion

In summary, Recombinant Human NDUFB6 Protein is an essential component of the respiratory chain complex I, playing a crucial role in the transfer of electrons and the production of ATP. Its structure, activity, and applications make it a valuable tool for research and potential therapeutic target for various diseases. Further studies on the function and regulation of NDUFB6 may lead to a better understanding of complex I-related disorders and the development of new treatments.

Recombinant Human NDUFB6 Protein, N-His-SUMO & C-Strep

There are no reviews yet.

Be the first to review “Recombinant Human NDUFB6 Protein, N-His-SUMO & C-Strep”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products